Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Hemoglobin subunit alpha Recombinant Protein | Hba recombinant protein

Recombinant Mouse Hemoglobin subunit alpha

Gene Names
Hba-a1; Hba; Hba1; Hbat1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hemoglobin subunit alpha; Recombinant Mouse Hemoglobin subunit alpha; Alpha-globin; Hemoglobin alpha chain; Hba recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-142aa; Full Length
Sequence
VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR
Sequence Length
142
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Hba recombinant protein
Involved in oxygen transport from the lung to the various peripheral tissues.
References
The complete sequence of a chromosomal mouse alpha-globin gene reveals elements conserved throughout vertebrate evolution.Nishioka Y., Leder P.Cell 18:875-882(1979) Hemoglobins of mice sequence and possible ambiguity at one position of the alpha chain.Popp R.A.J. Mol. Biol. 27:9-16(1967) Lubec G., Klug S., Kang S.U.Submitted (APR-2007) to UniProtKB Comparison of cloned mouse alpha- and beta-globin genes conservation of intervening sequence locations and extragenic homology.Leder A., Miller H.I., Hamer D.H., Seidman J.G., Norman B., Sullivan M., Leder P.Proc. Natl. Acad. Sci. U.S.A. 75:6187-6191(1978) Characterization and kinetics of synthesis of 15S beta-globin RNA, a putative precursor of beta-globin mRNA.Curtis P.J., Mantei N., Weissmann C.Cold Spring Harb. Symp. Quant. Biol. 42:971-984(1978) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013) Studies on the mouse hemoglobin loci. 8. A fourth alpha-chain phenotype.Popp R.A.J. Hered. 60:126-133(1969) Popp R.A.(In) Altman P.A., Katz D.D. (eds.) ;Inbred and genetically defined strains of laboratory animals, pp.105-105, Federation of American Societies for Experimental Biology, Bethesda (1979) The primary structure of genetic variants of mouse hemoglobin.Popp R.A., Bailiff E.G., Skow L.C., Whitney J.B. IIIBiochem. Genet. 20:199-208(1982)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
Hemoglobin subunit alpha
NCBI Official Synonym Full Names
hemoglobin alpha, adult chain 1
NCBI Official Symbol
Hba-a1
NCBI Official Synonym Symbols
Hba; Hba1; Hbat1
NCBI Protein Information
hemoglobin subunit alpha
UniProt Protein Name
Hemoglobin subunit alpha
Protein Family
UniProt Gene Name
Hba
UniProt Synonym Gene Names
Hba-a1
UniProt Entry Name
HBA_MOUSE

Uniprot Description

HBA1: Involved in oxygen transport from the lung to the various peripheral tissues. Defects in HBA1 may be a cause of Heinz body anemias (HEIBAN). This is a form of non-spherocytic hemolytic anemia of Dacie type 1. After splenectomy, which has little benefit, basophilic inclusions called Heinz bodies are demonstrable in the erythrocytes. Before splenectomy, diffuse or punctate basophilia may be evident. Most of these cases are probably instances of hemoglobinopathy. The hemoglobin demonstrates heat lability. Heinz bodies are observed also with the Ivemark syndrome (asplenia with cardiovascular anomalies) and with glutathione peroxidase deficiency. Defects in HBA1 are the cause of alpha-thalassemia (A- THAL). The thalassemias are the most common monogenic diseases and occur mostly in Mediterranean and Southeast Asian populations. The hallmark of alpha-thalassemia is an imbalance in globin-chain production in the adult HbA molecule. The level of alpha chain production can range from none to very nearly normal levels. Deletion of both copies of each of the two alpha-globin genes causes alpha(0)-thalassemia, also known as homozygous alpha thalassemia. Due to the complete absence of alpha chains, the predominant fetal hemoglobin is a tetramer of gamma-chains (Bart hemoglobin) that has essentially no oxygen carrying capacity. This causes oxygen starvation in the fetal tissues leading to prenatal lethality or early neonatal death. The loss of three alpha genes results in high levels of a tetramer of four beta chains (hemoglobin H), causing a severe and life-threatening anemia known as hemoglobin H disease. Untreated, most patients die in childhood or early adolescence. The loss of two alpha genes results in mild alpha-thalassemia, also known as heterozygous alpha-thalassemia. Affected individuals have small red cells and a mild anemia (microcytosis). If three of the four alpha-globin genes are functional, individuals are completely asymptomatic. Some rare forms of alpha-thalassemia are due to point mutations (non- deletional alpha-thalassemia). The thalassemic phenotype is due to unstable globin alpha chains that are rapidly catabolized prior to formation of the alpha-beta heterotetramers. Alpha(0)-thalassemia is associated with non-immune hydrops fetalis, a generalized edema of the fetus with fluid accumulation in the body cavities due to non-immune causes. Non- immune hydrops fetalis is not a diagnosis in itself but a symptom, a feature of many genetic disorders, and the end-stage of a wide variety of disorders. Defects in HBA1 are the cause of hemoglobin H disease (HBH). HBH is a form of alpha-thalassemia due to the loss of three alpha genes. This results in high levels of a tetramer of four beta chains (hemoglobin H), causing a severe and life-threatening anemia. Untreated, most patients die in childhood or early adolescence. Belongs to the globin family.

Protein type: Carrier

Cellular Component: hemoglobin complex; membrane

Molecular Function: haptoglobin binding; heme binding; organic acid binding; oxygen binding; peroxidase activity

Biological Process: erythrocyte development; in utero embryonic development

Research Articles on Hba

Similar Products

Product Notes

The Hba hba (Catalog #AAA1264434) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-142aa; Full Length. The amino acid sequence is listed below: VLSGEDKSNI KAAWGKIGGH GAEYGAEALE RMFASFPTTK TYFPHFDVSH GSAQVKGHGK KVADALASAA GHLDDLPGAL SALSDLHAHK LRVDPVNFKL LSHCLLVTLA SHHPADFTPA VHASLDKFLA SVSTVLTSKY R. It is sometimes possible for the material contained within the vial of "Hemoglobin subunit alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual