HAUS augmin-like complex subunit 7 (HAUS7) Recombinant Protein | HAUS7 recombinant protein
Recombinant Human HAUS augmin-like complex subunit 7 (HAUS7)
Gene Names
HAUS7; UIP1; UCHL5IP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HAUS augmin-like complex subunit 7 (HAUS7); Recombinant Human HAUS augmin-like complex subunit 7 (HAUS7); HAUS7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-368, Full length protein
Sequence
MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLATKMNELMEK
Sequence Length
368
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HAUS7 recombinant protein
This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,524 Da
NCBI Official Full Name
HAUS augmin-like complex subunit 7
NCBI Official Synonym Full Names
HAUS augmin like complex subunit 7
NCBI Official Symbol
HAUS7
NCBI Official Synonym Symbols
UIP1; UCHL5IP
NCBI Protein Information
HAUS augmin-like complex subunit 7
UniProt Protein Name
HAUS augmin-like complex subunit 7
Protein Family
UniProt Gene Name
HAUS7
UniProt Synonym Gene Names
UCHL5IP; UIP1
NCBI Description
This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2012]
Uniprot Description
Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
Research Articles on HAUS7
1. HAUS7 mutation may be associated with chromosome misalignment, resulting in severe oligozoospermia.
Similar Products
Product Notes
The HAUS7 haus7 (Catalog #AAA1463042) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-368, Full length protein. The amino acid sequence is listed below: MGGARLGARN MAGQDAGCGR GGDDYSEDEG DSSVSRAAVE VFGKLKDLNC PFLEGLYITE PKTIQELLCS PSEYRLEILE WMCTRVWPSL QDRFSSLKGV PTEVKIQEMT KLGHELMLCA PDDQELLKGC ACAQKQLHFM DQLLDTIRSL TIGCSSCSSL MEHFEDTREK NEALLGELFS SPHLQMLLNP ECDPWPLDMQ PLLNKQSDDW QWASASAKSE EEEKLAELAR QLQESAAKLH ALRTEYFAQH EQGAAAGAAD ISTLDQKLRL VTSDFHQLIL AFLQVYDDEL GECCQRPGPD LHPCGPIIQA THQNLTSYSQ LLQVVMAVAD TSAKAVETVK KQQGEQICWG GSSSVMSLAT KMNELMEK. It is sometimes possible for the material contained within the vial of "HAUS augmin-like complex subunit 7 (HAUS7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
