Glutathione transport system permease protein gsiD (gsiD) Recombinant Protein | yliD recombinant protein
Recombinant Glutathione transport system permease protein gsiD (gsiD)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutathione transport system permease protein gsiD (gsiD); Recombinant Glutathione transport system permease protein gsiD (gsiD); Glutathione transport system permease protein gsiD; yliD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-303
Sequence
MRLFNWRRQAVLNAMPLVKPDQVRTPWHEFWRRFRRQHMAMTAALFVILLIVVAIFARWIAPYDAENYFDYDNLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAAIGTLLGLLAGYYEGWWDRLSMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAVAIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLSFLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIKG
Sequence Length
303
Species
Escherichia coli O1:K1 / APEC
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,226 Da
NCBI Official Full Name
peptide transporter membrane protein
NCBI Official Symbol
yliD
NCBI Protein Information
peptide transporter membrane protein
UniProt Protein Name
Glutathione transport system permease protein GsiD
UniProt Gene Name
gsiD
UniProt Entry Name
GSID_ECOK1
Uniprot Description
Function: Part of the ABC transporter complex GsiABCD involved in glutathione import. Probably responsible for the translocation of the substrate across the membrane
By similarity.
Subunit structure: The complex is composed of two ATP-binding proteins (GsiA), two transmembrane proteins (GsiC and GsiD) and a solute-binding protein (GsiB)
Probable.
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the binding-protein-dependent transport system permease family.Contains 1 ABC transmembrane type-1 domain.
Similar Products
Product Notes
The yliD gsid (Catalog #AAA1257272) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-303. The amino acid sequence is listed below: MRLFNWRRQA VLNAMPLVKP DQVRTPWHEF WRRFRRQHMA MTAALFVILL IVVAIFARWI APYDAENYFD YDNLNNGPSL QHWFGVDSLG RDIFSRVLVG AQISLAAGVF AVFIGAAIGT LLGLLAGYYE GWWDRLSMRI CDVLFAFPGI LLAIAVVAVL GSGIANVIIA VAIFSIPAFA RLVRGNTLVL KQQTFIESAR SIGASDMTIL LRHILPGTVS SIVVFFTMRI GTSIISAASL SFLGLGAQPP TPEWGAMLNE ARADMVIAPH VAVFPALAIF LTVLAFNLLG DGLRDALDPK IKG. It is sometimes possible for the material contained within the vial of "Glutathione transport system permease protein gsiD (gsiD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
