Monothiol glutaredoxin-S16, chloroplastic (GRXS16) Recombinant Protein | GRXS16 recombinant protein
Recombinant Arabidopsis thaliana Monothiol glutaredoxin-S16, chloroplastic (GRXS16)
Gene Names
CXIP2; ATGRX2; AtGRXS16; CAX-interacting protein 2; F16M14.20; F16M14_20; GLUTAREDOXIN; glutaredoxin 16; GLUTAREDOXIN 2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Monothiol glutaredoxin-S16; chloroplastic (GRXS16); Recombinant Arabidopsis thaliana Monothiol glutaredoxin-S16; GRXS16 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
63-293, Full length protein
Sequence
ASAVKSLTETELLPITEADSIPSASGVYAVYDKSDELQFVGISRNIAASVSAHLKSVPELCGSVKVGIVEEPDKAVLTQAWKLWIEEHIKVTGKVPPGNKSGNNTFVKQTPRKKSDIRLTPGRHVELTVPLEELIDRLVKESKVVAFIKGSRSAPQCGFSQRVVGILESQGVDYETVDVLDDEYNHGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYENGELANILN
Sequence Length
231
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,206 Da
NCBI Official Full Name
CAX-interacting protein 2
NCBI Official Symbol
CXIP2
NCBI Official Synonym Symbols
ATGRX2; AtGRXS16; CAX-interacting protein 2; F16M14.20; F16M14_20; GLUTAREDOXIN; glutaredoxin 16; GLUTAREDOXIN 2
NCBI Protein Information
CAX-interacting protein 2
UniProt Protein Name
Bifunctional monothiol glutaredoxin-S16, chloroplastic
Protein Family
UniProt Gene Name
GRXS16
UniProt Synonym Gene Names
AtGrxS16
NCBI Description
Encodes protein homologous to CXIP1. CXIP1 is a PICOT domain containing protein interacts with CAX1, a high capacity calcium transporter. However, CXP2 does not interact with CAX1 and only moderately activates another calcium transporter CAX4.
Uniprot Description
May only reduce GSH-thiol disulfides, but not protein disulfides (Probable). Participates probably to the maturation of iron-sulfur proteins and to the regulation of the redox state of the BOLA proteins (Probable). The GRXS16-BOLA1 heterodimer binds a labile, oxygen sensitive iron-sulfur cluster (PubMed:24714563). Able to cleave linearized DNA in vitro (PubMed:23690600).
Similar Products
Product Notes
The GRXS16 grxs16 (Catalog #AAA1396626) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 63-293, Full length protein. The amino acid sequence is listed below: ASAVKSLTET ELLPITEADS IPSASGVYAV YDKSDELQFV GISRNIAASV SAHLKSVPEL CGSVKVGIVE EPDKAVLTQA WKLWIEEHIK VTGKVPPGNK SGNNTFVKQT PRKKSDIRLT PGRHVELTVP LEELIDRLVK ESKVVAFIKG SRSAPQCGFS QRVVGILESQ GVDYETVDVL DDEYNHGLRE TLKNYSNWPT FPQIFVKGEL VGGCDILTSM YENGELANIL N. It is sometimes possible for the material contained within the vial of "Monothiol glutaredoxin-S16, chloroplastic (GRXS16), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
