Western Blot (WB)
(WB Suggested Anti-MPP1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)
Rabbit MPP1 Polyclonal Antibody | anti-MPP1 antibody
MPP1 antibody - N-terminal region
Gene Names
MPP1; MRG1; PEMP; AAG12; EMP55; DXS552E
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MPP1; Polyclonal Antibody; MPP1 antibody - N-terminal region; anti-MPP1 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGG
Sequence Length
436
Applicable Applications for anti-MPP1 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rabbit: 86%; Rat: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MPP1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-MPP1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)
Related Product Information for anti-MPP1 antibody
This is a rabbit polyclonal antibody against MPP1. It was validated on Western Blot
Target Description: This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells.
Target Description: This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells.
Product Categories/Family for anti-MPP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47kDa
NCBI Official Full Name
55 kDa erythrocyte membrane protein isoform 4
NCBI Official Synonym Full Names
membrane palmitoylated protein 1
NCBI Official Symbol
MPP1
NCBI Official Synonym Symbols
MRG1; PEMP; AAG12; EMP55; DXS552E
NCBI Protein Information
55 kDa erythrocyte membrane protein
Protein Family
NCBI Description
This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Research Articles on MPP1
Similar Products
Product Notes
The MPP1 (Catalog #AAA3216358) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MPP1 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MPP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MPP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APGSPAQVKG QEVRKVRLIQ FEKVTEEPMG ITLKLNEKQS CTVARILHGG. It is sometimes possible for the material contained within the vial of "MPP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
