Putative gustatory receptor 66a (Gr66a) Recombinant Protein | Gr66a recombinant protein
Recombinant Drosophila melanogaster Putative gustatory receptor 66a (Gr66a)
Gene Names
Gr66a; CG7189; DmelCG7189; Gr66; Gr66A; GR66a; GR66A; Gr66C1; GR66C1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative gustatory receptor 66a (Gr66a); Recombinant Drosophila melanogaster Putative gustatory receptor 66a (Gr66a); Gr66a recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-527aa; full length protein
Sequence
MAQAEDAVQPLLQQFQQLFFISKIAGILPQDLEKFRSRNLLEKSRNGMIYMLSTLILYVV LYNILIYSFGEEDRSLKASQSTLTFVIGLFLTYIGLIMMVSDQLTALRNQGRIGELYERI RLVDERLYKEGCVMDNSTIGRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLLWIVSA IPTFINTLDKIWFAVSLYALKERFEAINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQP PQYDSNLEYLYKELGGMDIGSIGKSSVSGSGKNKVAPVAHSMNSFGEAIDAASRKPPPPP LATNMVHESELGNAAKVEEKLNNLCQVHDEICEIGKALNELWSYPILSLMAYGFLIFTAQ LYFLYCATQYQSIPSLFRSAKNPFITVIVLSYTSGKCVYLIYLSWKTSQASKRTGISLHK CGVVADDNLLYEIVNHLSLKLLNHSVDFSACGFFTLDMETLYGVSGGITSYLIILIQFNL AAQQAKEAIQTFNSLNDTAGLVGAATDMDNISSTLRDFVTTTMTPAV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gr66a recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,081 Da
NCBI Official Full Name
gustatory receptor 66a
NCBI Official Synonym Full Names
Gustatory receptor 66a
NCBI Official Symbol
Gr66a
NCBI Official Synonym Symbols
CG7189; DmelCG7189; Gr66; Gr66A; GR66a; GR66A; Gr66C1; GR66C1
NCBI Protein Information
CG7189 gene product from transcript CG7189-RB
UniProt Protein Name
Gustatory receptor for bitter taste 66a
Protein Family
UniProt Gene Name
Gr66a
UniProt Entry Name
GR66A_DROME
Uniprot Description
Gustatory receptor required for response to the bitter in taste neurons. Gr66a cells respond to bitter compounds such as caffeine, theophylline, threonine or valine. Flies avoid bitter substances, suggesting that Gr66a neuron activity is sufficient to mediate avoidance behavior. Required for sensing and avoiding N,N-Diethyl-meta-toluamide (DEET), the most widely used insect repellent worldwide, as well as to L-canavanine, a plant-derived insecticide. Gr66a neurons are also involved in the sex-specific perception of molecules inducing male avoidance behavior, probably through sensing 7-tricosene (7-T), a male cuticular pheromone and leading to inhibition of male-male courtship. Finally, plays also a role in oviposition behavior, in which females evaluate their environment and choose to lay eggs on substrates they may find aversive in other contexts.
Research Articles on Gr66a
Similar Products
Product Notes
The Gr66a gr66a (Catalog #AAA7016344) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-527aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gr66a gr66a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAQAEDAVQP LLQQFQQLFF ISKIAGILPQ DLEKFRSRNL LEKSRNGMIY MLSTLILYVV LYNILIYSFG EEDRSLKASQ STLTFVIGLF LTYIGLIMMV SDQLTALRNQ GRIGELYERI RLVDERLYKE GCVMDNSTIG RRIRIMLIMT VIFELSILVS TYVKLVDYSQ WMSLLWIVSA IPTFINTLDK IWFAVSLYAL KERFEAINAT LEELVDTHEK HKLWLRGNQE VPPPLDSSQP PQYDSNLEYL YKELGGMDIG SIGKSSVSGS GKNKVAPVAH SMNSFGEAID AASRKPPPPP LATNMVHESE LGNAAKVEEK LNNLCQVHDE ICEIGKALNE LWSYPILSLM AYGFLIFTAQ LYFLYCATQY QSIPSLFRSA KNPFITVIVL SYTSGKCVYL IYLSWKTSQA SKRTGISLHK CGVVADDNLL YEIVNHLSLK LLNHSVDFSA CGFFTLDMET LYGVSGGITS YLIILIQFNL AAQQAKEAIQ TFNSLNDTAG LVGAATDMDN ISSTLRDFVT TTMTPAV. It is sometimes possible for the material contained within the vial of "Putative gustatory receptor 66a (Gr66a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
