Epididymal secretory glutathione peroxidase (GPX5) Recombinant Protein | GPX5 recombinant protein

Recombinant Human Epididymal secretory glutathione peroxidase (GPX5)

Cat. Num. AAA7136934

• Gene Names: GPX5; HEL-S-75p
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Epididymal secretory glutathione peroxidase (GPX5); Recombinant Human Epididymal secretory glutathione peroxidase (GPX5); Epididymis-specific glutathione peroxidase-like protein; GPX5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process); If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyop
• Sequence Positions: 1-100aa, Full Length of Isoform 2
• Sequence: MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM

• Species: Human
• Tag: N-terminal 6xHis-GST-tagged
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Product Categories/Family for GPX5 recombinant protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 6016164
• NCBI GeneID: 2880
• UniProt Accession #: O75715; A1A4Y0
• Molecular Weight: 221
• NCBI Official Full Name: Epididymal secretory glutathione peroxidase
• NCBI Official Synonym Full Names: glutathione peroxidase 5
• NCBI Official Symbol: GPX5
• NCBI Official Synonym Symbols: HEL-S-75p
• NCBI Protein Information: epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; epididymis secretory sperm binding protein Li 75p; epididymis-specific glutathione peroxidase-like protein
• UniProt Protein Name: Epididymal secretory glutathione peroxidase
• Protein Family: Epididymal secretory glutathione peroxidase
• UniProt Gene Name: GPX5
• UniProt Synonym Gene Names: EGLP; GPx-5; GSHPx-5
• UniProt Entry Name: GPX5_HUMAN

NCBI Description

This gene belongs to the glutathione peroxidase family. It is specifically expressed in the epididymis in the mammalian male reproductive tract, and is androgen-regulated. Unlike mRNAs for other characterized glutathione peroxidases, this mRNA does not contain a selenocysteine (UGA) codon. Thus, the encoded protein is selenium-independent, and has been proposed to play a role in protecting the membranes of spermatozoa from the damaging effects of lipid peroxidation and/or preventing premature acrosome reaction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

GPX5: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Belongs to the glutathione peroxidase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.11.1.9; Secreted, signal peptide; Other Amino Acids Metabolism - glutathione; Oxidoreductase; Lipid Metabolism - arachidonic acid; Secreted

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: extracellular space

Molecular Function: glutathione peroxidase activity

Biological Process: response to oxidative stress; lipid metabolic process