SDS-PAGE
Epididymal secretory glutathione peroxidase (GPX5) Recombinant Protein | GPX5 recombinant protein
Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Epididymal secretory glutathione peroxidase (GPX5); Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5); Epididymis-specific glutathione peroxidase-like protein; EGLP; Glutathione peroxidase 5; GPx-5; GSHPx; GPX5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-219aa; Full Length of Mature Protein
Sequence
NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
Sequence Length
219
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for GPX5 recombinant protein
May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
Product Categories/Family for GPX5 recombinant protein
References
"Molecular cloning and characterization of the epididymis-specific glutathione peroxidase-like protein secreted in the porcine epididymal fluid."Okamura N., Iwaki Y., Hiramoto S., Tamba M., Bannai S., Sugita Y., Syntin P., Dacheux F., Dacheux J.-L.Biochim. Biophys. Acta 1336:99-109(1997)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42.6 kDa
NCBI Official Full Name
epididymal secretory glutathione peroxidase
NCBI Official Symbol
GPX5
NCBI Protein Information
epididymal secretory glutathione peroxidase
UniProt Protein Name
Epididymal secretory glutathione peroxidase
Protein Family
UniProt Gene Name
GPX5
UniProt Synonym Gene Names
EGLP; GPx-5; GSHPx-5
Uniprot Description
May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
Research Articles on GPX5
Similar Products
Product Notes
The GPX5 gpx5 (Catalog #AAA7055008) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-219aa; Full Length of Mature Protein. The amino acid sequence is listed below: NSNLEKMDCY KDVTGTIYDY DAFTLNGNEH IQFKQYAGKH VLFVNVATYC GLTAQYPELN TLQEELKPFG LVVLGFPCNQ FGKQEPGENS EILLGLKYVR PGGGYVPNFQ LFEKGDVNGE KEQKVFTFLK HSCPHPSELI GSIGYISWEP IRVHDIRWNF EKFLVGPDGV PVMRWVHETP ISTVKSDILA YLKQFKTE. It is sometimes possible for the material contained within the vial of "Epididymal secretory glutathione peroxidase (GPX5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
