Alanine aminotransferase 1 (GPT) Recombinant Protein | GPT recombinant protein
Recombinant Bovine Alanine aminotransferase 1 (GPT)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alanine aminotransferase 1 (GPT); Recombinant Bovine Alanine aminotransferase 1 (GPT); GPT recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-496, Full length protein
Sequence
ALRAGEHSQEAANGLKEKVLTLDSMNPYVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQIPITFPRQVLALCVHPDLLNSPDFPDDAKRRAERILQACGGHSLGAYSISAGVQMIREDVARYIERRDGGIPADPNNIFLSTGASDAIVTVLKLLVTGEGRTRTGVLIPIPQYPLYSAALAEFNAVQVDYYLDEERAWALDVAELRRALRQARDHCRPRALCVINPGNPTGQVQTRECIEDVIRFAYEEKLFLLADEVYQDNVYAESSQFHSFKKVLTEMGPPYAAQQELASFHSISKGYMGECGFRGGYVEVVNMDAAVKQQMQKLRSVRLCPPTPGQVLLDVAVSPPAPSDPSFPRFQAERRAVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPRVQLPPRAVQRAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPLLEKLSQFHAKFTREYS
Sequence Length
495
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,275 Da
NCBI Official Full Name
alanine aminotransferase 1
NCBI Official Synonym Full Names
glutamic--pyruvic transaminase
NCBI Official Symbol
GPT
NCBI Protein Information
alanine aminotransferase 1
UniProt Protein Name
Alanine aminotransferase 1
Protein Family
UniProt Gene Name
GPT
UniProt Synonym Gene Names
GPT1; ALT1; GPT 1
Uniprot Description
Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles ().
Research Articles on GPT
Similar Products
Product Notes
The GPT gpt (Catalog #AAA1205862) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-496, Full length protein. The amino acid sequence is listed below: ALRAGEHSQE AANGLKEKVL TLDSMNPYVR RVEYAVRGPI VQRALELEQE LRQGVKKPFT EVIRANIGDA QAMGQIPITF PRQVLALCVH PDLLNSPDFP DDAKRRAERI LQACGGHSLG AYSISAGVQM IREDVARYIE RRDGGIPADP NNIFLSTGAS DAIVTVLKLL VTGEGRTRTG VLIPIPQYPL YSAALAEFNA VQVDYYLDEE RAWALDVAEL RRALRQARDH CRPRALCVIN PGNPTGQVQT RECIEDVIRF AYEEKLFLLA DEVYQDNVYA ESSQFHSFKK VLTEMGPPYA AQQELASFHS ISKGYMGECG FRGGYVEVVN MDAAVKQQMQ KLRSVRLCPP TPGQVLLDVA VSPPAPSDPS FPRFQAERRA VLAELAAKAK LTEQVFNEAP GIRCNPVQGA MYSFPRVQLP PRAVQRAQEL GLAPDMFFCL RLLEETGICV VPGSGFGQRE GTYHFRMTIL PPMEKLRPLL EKLSQFHAKF TREYS. It is sometimes possible for the material contained within the vial of "Alanine aminotransferase 1 (GPT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
