Probable G-protein coupled receptor 85 (GPR85) Recombinant Protein | GPR85 recombinant protein
Recombinant Human Probable G-protein coupled receptor 85 (GPR85)
Gene Names
GPR85; SREB; SREB2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable G-protein coupled receptor 85 (GPR85); Recombinant Human Probable G-protein coupled receptor 85 (GPR85); GPR85 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-370aa; Full length protein
Sequence
MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLL DLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRY LAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFR ANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAA ANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKS RLPREPYCVI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GPR85 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,995 Da
NCBI Official Full Name
probable G-protein coupled receptor 85
NCBI Official Synonym Full Names
G protein-coupled receptor 85
NCBI Official Symbol
GPR85
NCBI Official Synonym Symbols
SREB; SREB2
NCBI Protein Information
probable G-protein coupled receptor 85
UniProt Protein Name
Probable G-protein coupled receptor 85
Protein Family
UniProt Gene Name
GPR85
UniProt Synonym Gene Names
SREB2
UniProt Entry Name
GPR85_HUMAN
NCBI Description
Members of the G protein-coupled receptor (GPCR) family, such as GPR85, have a similar structure characterized by 7 transmembrane domains. Activation of GPCRs by extracellular stimuli, such as neurotransmitters, hormones, or light, induces an intracellular signaling cascade mediated by heterotrimeric GTP-binding proteins, or G proteins (Matsumoto et al., 2000 [PubMed 10833454]).[supplied by OMIM, Aug 2008]
Uniprot Description
GPR85: Orphan receptor. Belongs to the G-protein coupled receptor 1 family.
Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 7q31
Cellular Component: endoplasmic reticulum; integral to membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; protein binding
Biological Process: G-protein coupled receptor protein signaling pathway; signal transduction
Research Articles on GPR85
Similar Products
Product Notes
The GPR85 gpr85 (Catalog #AAA7016262) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-370aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GPR85 gpr85 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MANYSHAADN ILQNLSPLTA FLKLTSLGFI IGVSVVGNLL ISILLVKDKT LHRAPYYFLL DLCCSDILRS AICFPFVFNS VKNGSTWTYG TLTCKVIAFL GVLSCFHTAF MLFCISVTRY LAIAHHRFYT KRLTFWTCLA VICMVWTLSV AMAFPPVLDV GTYSFIREED QCTFQHRSFR ANDSLGFMLL LALILLATQL VYLKLIFFVH DRRKMKPVQF VAAVSQNWTF HGPGASGQAA ANWLAGFGRG PTPPTLLGIR QNANTTGRRR LLVLDEFKME KRISRMFYIM TFLFLTLWGP YLVACYWRVF ARGPVVPGGF LTAAVWMSFA QAGINPFVCI FSNRELRRCF STTLLYCRKS RLPREPYCVI. It is sometimes possible for the material contained within the vial of "Probable G-protein coupled receptor 85 (GPR85), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
