Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Endothelin B receptor-like protein 2 (Gpr37l1) Recombinant Protein | Gpr37l1 recombinant protein

Recombinant Mouse Endothelin B receptor-like protein 2 (Gpr37l1)

Gene Names
Gpr37l1; CAG-18; D0Kist8; AW047233
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endothelin B receptor-like protein 2 (Gpr37l1); Recombinant Mouse Endothelin B receptor-like protein 2 (Gpr37l1); Gpr37l1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
25-481aa; full length protein
Sequence
AATSSLGGHRAKVQEQQSRPRRGTKDEGPKEVQHYVPEEWAEYPKPIHPAGLQPTKTLEA TSPNPDKDGATPGNGQELRVNLTGTPSQRLQIQNPLYPVTESSYSAYAIMLLALVVFAVG IVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVLFFCLPIVIFNEITKQRLLGDVSCR AVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVRPIERCQSILAKLAVIWVGSMMLAV PELLLWQLAQEPAPTAGTVDSCIMKPSADLPESVYSLVMTYQNARMWWYFGCYFCLPILF TVTCQLVTWRVRGPPGRKPECRAGRHEQCESQLNSTVVGLTVVYAFCTLPENVCNIVVAY LSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCICRPLGQAFLDCCCCCCCEECGGASD SSATVSADSKLKAEVSSSIYFHKPRESPPLLPLGTPC
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gpr37l1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,729 Da
NCBI Official Full Name
prosaposin receptor GPR37L1
NCBI Official Synonym Full Names
G protein-coupled receptor 37-like 1
NCBI Official Symbol
Gpr37l1
NCBI Official Synonym Symbols
CAG-18; D0Kist8; AW047233
NCBI Protein Information
prosaposin receptor GPR37L1
UniProt Protein Name
Prosaposin receptor GPR37L1
Protein Family
UniProt Gene Name
Gpr37l1
UniProt Synonym Gene Names
Etbrlp2; ETBR-LP-2
UniProt Entry Name
ETBR2_MOUSE

Uniprot Description

GPR37L1: Orphan receptor. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Cellular Component: integral to membrane; membrane; plasma membrane; receptor complex

Molecular Function: G-protein coupled receptor activity; peptide binding; peptide receptor activity, G-protein coupled; protein binding; signal transducer activity

Biological Process: G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase inhibiting pathway; negative regulation of astrocyte differentiation; negative regulation of neuron differentiation; negative regulation of smoothened signaling pathway; positive regulation of granule cell precursor proliferation; positive regulation of MAPKKK cascade; signal transduction

Research Articles on Gpr37l1

Similar Products

Product Notes

The Gpr37l1 gpr37l1 (Catalog #AAA7016207) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-481aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gpr37l1 gpr37l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AATSSLGGHR AKVQEQQSRP RRGTKDEGPK EVQHYVPEEW AEYPKPIHPA GLQPTKTLEA TSPNPDKDGA TPGNGQELRV NLTGTPSQRL QIQNPLYPVT ESSYSAYAIM LLALVVFAVG IVGNLSVMCI VWHSYYLKSA WNSILASLAL WDFLVLFFCL PIVIFNEITK QRLLGDVSCR AVPFMEVSSL GVTTFSLCAL GIDRFHVATS TLPKVRPIER CQSILAKLAV IWVGSMMLAV PELLLWQLAQ EPAPTAGTVD SCIMKPSADL PESVYSLVMT YQNARMWWYF GCYFCLPILF TVTCQLVTWR VRGPPGRKPE CRAGRHEQCE SQLNSTVVGL TVVYAFCTLP ENVCNIVVAY LSTELTRQTL DLLGLINQFS TFFKGAITPV LLLCICRPLG QAFLDCCCCC CCEECGGASD SSATVSADSK LKAEVSSSIY FHKPRESPPL LPLGTPC. It is sometimes possible for the material contained within the vial of "Endothelin B receptor-like protein 2 (Gpr37l1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.