12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor (Gpr31c) Recombinant Protein | Gpr31c recombinant protein
Recombinant Mouse 12- (S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
Gene Names
Gpr31b; Gpr31; Gpr31c; 12-HETER; GPR31c(t)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
12-(S)-hydroxy-5; 8; 10; 14-eicosatetraenoic acid receptor (Gpr31c); Recombinant Mouse 12- (S)-hydroxy-5; 14-eicosatetraenoic acid receptor; Gpr31c recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-319aa; full length protein
Sequence
MERTNCSAASTVVETAVGTMLTLECVLGLMGNAVALWTFFYRLKVWKPYAVYLFNLVVAD LLLATSLPFFAAFYLKGKTWKLGHMPCQVLLFLLAFSRGVGVAFLTTVALDRYLRVVHPR LRVNLLSLRAAWGISSLIWLLMVVLTPQNLLTCRTTQNSTECPSFYPTGGAKAIATCQEV LFFLQVLLPFGLISFCNSGLIRTLQKRLRESDKQPRIRRARVLVAIVLLLFGLCFLPSVL TRVLVHIFQEFKSCSVQQAIVRASDIAGSLTCLHSTLSPAIYCFSNPAFTHSYRKVLKSL RGRRKAAESPSDNLRDSYS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gpr31c recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,642 Da
NCBI Official Full Name
12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
NCBI Official Synonym Full Names
G protein-coupled receptor 31, D17Leh66b region
NCBI Official Symbol
Gpr31b
NCBI Official Synonym Symbols
Gpr31; Gpr31c; 12-HETER; GPR31c(t)
NCBI Protein Information
12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
UniProt Protein Name
12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
UniProt Gene Name
Gpr31
UniProt Synonym Gene Names
Gpr31b; Gpr31c; 12-(S)-HETE receptor; 12-HETER
UniProt Entry Name
GPR31_MOUSE
Uniprot Description
GPR31: High-affinity receptor for 12-(S)-hydroxy-5,8,10,14- eicosatetraenoic acid (12-S-HETE). 12-(S)-HETE is an arachidonic acid metabolite secreted by platelets and tumor cells, and known to induce endothelial cells retraction allowing invasive cell access to the subendothelial matrix, which is a critical step for extravasation or metastasis. Ligand-binding lead to activation of ERK1/2 (MAPK3/MAPK1), MEK, and NF-kappa-B. Belongs to the G-protein coupled receptor 1 family.
Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; Motility/polarity/chemotaxis; GPCR, family 1
Cellular Component: integral to membrane; membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; signal transducer activity
Biological Process: G-protein coupled receptor protein signaling pathway; signal transduction
Similar Products
Product Notes
The Gpr31c gpr31 (Catalog #AAA7016188) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-319aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gpr31c gpr31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MERTNCSAAS TVVETAVGTM LTLECVLGLM GNAVALWTFF YRLKVWKPYA VYLFNLVVAD LLLATSLPFF AAFYLKGKTW KLGHMPCQVL LFLLAFSRGV GVAFLTTVAL DRYLRVVHPR LRVNLLSLRA AWGISSLIWL LMVVLTPQNL LTCRTTQNST ECPSFYPTGG AKAIATCQEV LFFLQVLLPF GLISFCNSGL IRTLQKRLRE SDKQPRIRRA RVLVAIVLLL FGLCFLPSVL TRVLVHIFQE FKSCSVQQAI VRASDIAGSL TCLHSTLSPA IYCFSNPAFT HSYRKVLKSL RGRRKAAESP SDNLRDSYS. It is sometimes possible for the material contained within the vial of "12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor (Gpr31c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
