(Rhesus macaque) G-protein coupled receptor 1 (GPR1) Recombinant Protein | GPR1 recombinant protein
Recombinant Macaca mulatta (Rhesus macaque) G-protein coupled receptor 1 (GPR1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) G-protein coupled receptor 1 (GPR1); Recombinant Macaca mulatta (Rhesus macaque) G-protein coupled receptor 1 (GPR1); Recombinant (Rhesus macaque) G-protein coupled receptor 1 (GPR1); G-protein coupled receptor 1; GPR1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-355
Sequence
MEDLEETLFEEFENYSYALDYYSLESDLEEKVQLGVVHWVSLVLYCLSFVLGIPGNAIVIWFTGFKWKKTVSTLWFLNLAIADFIFLLFLPLYISYVVMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTVIRHHVLTWVKFIVGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILAVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Sequence Length
355
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,361 Da
NCBI Official Full Name
G-protein coupled receptor 1
NCBI Official Symbol
GPR1
NCBI Protein Information
G-protein coupled receptor 1; putative chemokine receptor; probable G-protein coupled receptor 1
UniProt Protein Name
G-protein coupled receptor 1
Protein Family
UniProt Gene Name
GPR1
UniProt Entry Name
GPR1_MACMU
Uniprot Description
Function: Receptor for the inflammation-associated leukocyte chemoattractant chemerin/RARRES2 suggesting a role for this receptor in the regulation of inflammation. Can act as a coreceptor for HIV-1
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Similar Products
Product Notes
The GPR1 gpr1 (Catalog #AAA1003631) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-355. The amino acid sequence is listed below: MEDLEETLFE EFENYSYALD YYSLESDLEE KVQLGVVHWV SLVLYCLSFV LGIPGNAIVI WFTGFKWKKT VSTLWFLNLA IADFIFLLFL PLYISYVVMN FHWPFGIWLC KANSFTAQLN MFASVFFLTV ISLDHYIHLI HPVLSHRHRT LKNSLIVIIF IWLLASLIGG PALYFRDTVE FNNHTLCYNN FQKHDPDLTV IRHHVLTWVK FIVGYLFPLL TMSICYLCLI FKVKKRSILI SSRHFWTILA VVVAFVVCWT PYHLFSIWEL TIHHNSYSHH VMQAGIPLST GLAFLNSCLN PILYVLISKK FQARFRSSVA EILKYTLWEV SCSGTVSEQL RNSETKNLCL LETAQ. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) G-protein coupled receptor 1 (GPR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
