Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Pre-glycoprotein polyprotein GP complex (GPC) Recombinant Protein | GPC recombinant protein

Recombinant Mopeia virus Pre-glycoprotein polyprotein GP complex (GPC)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pre-glycoprotein polyprotein GP complex (GPC); Recombinant Mopeia virus Pre-glycoprotein polyprotein GP complex (GPC); Recombinant Pre-glycoprotein polyprotein GP complex (GPC); Pre-glycoprotein polyprotein GP complex; Pre-GP-C Cleaved into the following 3 chains: 1. Stable signal peptide; 2. SSP 3. Glycoprotein G1; 4. GP1 5. Glycoprotein G2; 6. GP2; GPC recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
258-489
Sequence
GLFTWTLSDSEGNDMPGGYCLTRSMLIGLDLKCFGNTAIAKCNQAHDEEFCDMLRLFDFNKQAISKLRSEVQQSINLINKAVNALINDQLVMRNHLRDLMGIPYCNYSKFWYLNDTRTGRTSLPKCWLVTNGSYLNETQFSTEIEQEANNMFTDMLRKEYEKRQSTTPLGLVDLFVFSTSFYLISVFLHLIKIPTHRHIKGKPCPKPHRLNHMAICSCGFYKQPGLPTQWKR
Sequence Length
489
Species
Mopeia virus (MOPV)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
55,987 Da
NCBI Official Full Name
Pre-glycoprotein polyprotein GP complex
UniProt Protein Name
Pre-glycoprotein polyprotein GP complex
UniProt Gene Name
GPC
UniProt Synonym Gene Names
GP-C; Pre-GP-C; SSP; GP1; GP2
UniProt Entry Name
GLYC_MOPEI

Uniprot Description

Function: The stable signal peptide (SSP) is cleaved and functions as a signal peptide. In addition, it is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion

By similarity.Glycoprotein G1 binds to the host receptor

Potential.Glycoprotein G2 is a viral fusion protein. Membrane fusion is mediated by conformational changes induced upon acidification in the endosome

Potential.

Subunit structure: Glycoprotein G1 is a homotetramer; disulfide-linked

Potential. Glycoprotein G2 is a homotetramer

Potential. GP2 homotetramers bind through ionic interactions with GP1 homotetramers to form, with the stable signal peptide, the GP complex. The GP-C polyprotein interacts with host protease MBTPS1/SKI-1; this results in polyprotein processing

By similarity.

Subcellular location: Stable signal peptide: Virion membrane; Multi-pass membrane protein

Potential. Host endoplasmic reticulum membrane; Multi-pass membrane protein

Potential. Host Golgi apparatus membrane; Multi-pass membrane protein

Potential. Host cell membrane; Multi-pass membrane protein

Potential. Glycoprotein G1: Virion membrane; Peripheral membrane protein

Potential. Host endoplasmic reticulum membrane; Peripheral membrane protein

Potential. Host Golgi apparatus membrane; Peripheral membrane protein

Potential. Host cell membrane; Peripheral membrane protein

Potential. Glycoprotein G2: Virion membrane; Single-pass membrane protein

Potential. Host endoplasmic reticulum membrane; Single-pass membrane protein

Potential. Host Golgi apparatus membrane; Single-pass membrane protein

Potential. Host cell membrane; Single-pass membrane protein

Potential. Note: Binding to the stable signal peptide masks endogenous ER localization signals in the cytoplasmic domain of G2 to ensure that only the fully assembled, tripartite GP complex is transported for virion assembly

By similarity.

Domain: The cytoplasmic domain of GP2 plays a role in ER location and binds to the SSP.

Post-translational modification: The SSP remains stably associated with the GP complex following cleavage by signal peptidase and plays crucial roles in the trafficking of GP through the secretory pathway

By similarity.Specific enzymatic cleavages in vivo yield mature proteins. GP-C polyprotein is cleaved in the endoplasmic reticulum by the host protease MBTPS1. Only cleaved glycoprotein is incorporated into virions.

Sequence similarities: Belongs to the arenaviridae GPC protein family.

Similar Products

Product Notes

The Pre-glycoprotein polyprotein GP complex (GPC) gpc (Catalog #AAA1165231) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 258-489. The amino acid sequence is listed below: GLFTWTLSDS EGNDMPGGYC LTRSMLIGLD LKCFGNTAIA KCNQAHDEEF CDMLRLFDFN KQAISKLRSE VQQSINLINK AVNALINDQL VMRNHLRDLM GIPYCNYSKF WYLNDTRTGR TSLPKCWLVT NGSYLNETQF STEIEQEANN MFTDMLRKEY EKRQSTTPLG LVDLFVFSTS FYLISVFLHL IKIPTHRHIK GKPCPKPHRL NHMAICSCGF YKQPGLPTQW KR. It is sometimes possible for the material contained within the vial of "Pre-glycoprotein polyprotein GP complex (GPC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.