Glycerol-3-phosphate acyltransferase 3 (Agpat9) Recombinant Protein | Agpat9 recombinant protein
Recombinant Mouse Glycerol-3-phosphate acyltransferase 3 (Agpat9)
Gene Names
Agpat9; Gpat3; GPAT-3; mGPAT3; 1-AGPAT; 1-AGPAT 9; 4933408F15; 4933407I02Rik; A230097K15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycerol-3-phosphate acyltransferase 3 (Agpat9); Recombinant Mouse Glycerol-3-phosphate acyltransferase 3 (Agpat9); Agpat9 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-438aa; full length protein
Sequence
MEGADLAVKLLSTWLTLVGGLILLPSAFGLSLGISEIYMKILVKTLEWATLRIQKGAPKE SALKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE LVSWNLLTRTNVNFQYISPRLTMVWVLGVLVRYCFLLPLRVTLAFIGISLLIIGTTLVGQ LPDSSLKNWLSELVHLTCCRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILAT DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI FPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLVSYLLRIMTSW AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQ KNYSKMIVGNGSPNLARD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Agpat9 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,000 Da
NCBI Official Full Name
glycerol-3-phosphate acyltransferase 3
NCBI Official Synonym Full Names
1-acylglycerol-3-phosphate O-acyltransferase 9
NCBI Official Symbol
Agpat9
NCBI Official Synonym Symbols
Gpat3; GPAT-3; mGPAT3; 1-AGPAT; 1-AGPAT 9; 4933408F15; 4933407I02Rik; A230097K15Rik
NCBI Protein Information
glycerol-3-phosphate acyltransferase 3
UniProt Protein Name
Glycerol-3-phosphate acyltransferase 3
UniProt Gene Name
Gpat3
UniProt Synonym Gene Names
GPAT-3; 1-AGP acyltransferase 9; 1-AGPAT 9; mGPAT3; LPAAT-theta
UniProt Entry Name
GPAT3_MOUSE
Uniprot Description
AGPAT9: Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis. Overexpression activates the mTOR pathway. Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Protein type: EC 2.3.1.15; Membrane protein, integral; Transferase; EC 2.3.1.51; Membrane protein, multi-pass
Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral to membrane; membrane
Molecular Function: 1-acylglycerol-3-phosphate O-acyltransferase activity; glycerol-3-phosphate O-acyltransferase activity; transferase activity; transferase activity, transferring acyl groups
Biological Process: lipid metabolic process; metabolic process; phospholipid biosynthetic process; regulation of TOR signaling pathway; triacylglycerol biosynthetic process
Research Articles on Agpat9
Similar Products
Product Notes
The Agpat9 gpat3 (Catalog #AAA7007410) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-438aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Agpat9 gpat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEGADLAVKL LSTWLTLVGG LILLPSAFGL SLGISEIYMK ILVKTLEWAT LRIQKGAPKE SALKNSASVG IIQRDESPME KGLSGLRGRD FELSDVFYFS KKGLEAIVED EVTQRFSSEE LVSWNLLTRT NVNFQYISPR LTMVWVLGVL VRYCFLLPLR VTLAFIGISL LIIGTTLVGQ LPDSSLKNWL SELVHLTCCR ICVRSLSGTI HYHNKQYRPQ KGGICVANHT SPIDVLILAT DGCYAMVGQV HGGLMGIIQR AMVKACPHVW FERSEIKDRH LVTKRLKEHI ADKKKLPILI FPEGTCINNT SVMMFKKGSF EIGGTIYPVA IKYNPQFGDA FWNSSKYNLV SYLLRIMTSW AIVCDVWYMP PMTREEGEDA VQFANRVKSA IAVQGGLTEL PWDGGLKRAK VKDTFKEEQQ KNYSKMIVGN GSPNLARD. It is sometimes possible for the material contained within the vial of "Glycerol-3-phosphate acyltransferase 3 (Agpat9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
