Glycosylphosphatidylinositol anchor attachment 1 protein (Gpaa1) Recombinant Protein | Gpaa1 recombinant protein
Recombinant Mouse Glycosylphosphatidylinositol anchor attachment 1 protein (Gpaa1)
Gene Names
Gpaa1; mGAA1; C80044
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycosylphosphatidylinositol anchor attachment 1 protein (Gpaa1); Recombinant Mouse Glycosylphosphatidylinositol anchor attachment 1 protein (Gpaa1); Gpaa1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-621aa; full length protein
Sequence
GLLSDPVRRRALARIVLRLNTPLCVLSYVAGIAWFLALAFPPLTQRTYMSENAMGSTMVE EQFVGGDRARSFARDFAAHRKKPGALPVAWLERSMRSVGLEVYTQSFSRKLPFPDETHER YMVSGTNVYGILRAPRSASTESLVLTVPCGPDATNSQAVGLLLALAAHFRGQIYWAKDII FLVTDHDLLGTEAWLEAYHDINVTGIQSSPLQGRAGAIQAAVALELSSDVVTSLDVTVEG LNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPQDWTSLEGPLQGLQTLLLMVLRQASGR PHGPHGLFLRYGVEALTLRGINSFRQYKYDLATVGKALEGMFRKLNHLLERLHQSFFFYL LPALSRFVSIGLYMPATGFLLLVLGLKALELWMQLHQAGVNPEEAGKAPSPGTPLLPTQG VGLASLTAPLLISQAMGLALYFLPVLGQHLATQHFPVAEAEAVVLTLLAIYVAGLALPHN THRVVNSQVPDRGWMALKLVALIYLALQLGCIALLNFSLGFLLAATMVPAAALAKPHGPR TLYAALLVVTSPAVTLFGSLFLWRELLEVPLSLAEGWQLFLTALAQGVLEHYTYGALLFP ILALGLYPCWLLFWNVLFWK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gpaa1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
67,949 Da
NCBI Official Full Name
glycosylphosphatidylinositol anchor attachment 1 protein
NCBI Official Synonym Full Names
GPI anchor attachment protein 1
NCBI Official Symbol
Gpaa1
NCBI Official Synonym Symbols
mGAA1; C80044
NCBI Protein Information
glycosylphosphatidylinositol anchor attachment 1 protein
UniProt Protein Name
Glycosylphosphatidylinositol anchor attachment 1 protein
Protein Family
UniProt Gene Name
Gpaa1
UniProt Synonym Gene Names
Gaa1; GPI anchor attachment protein 1; mGAA1
UniProt Entry Name
GPAA1_MOUSE
Uniprot Description
GPAA1: Essential for GPI-anchoring of precursor proteins but not for GPI synthesis. Acts before or during formation of the carbonyl intermediate. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; Membrane protein, integral; Endoplasmic reticulum
Cellular Component: endoplasmic reticulum; GPI-anchor transamidase complex; integral to membrane; integral to plasma membrane; membrane
Molecular Function: GPI-anchor transamidase activity
Biological Process: attachment of GPI anchor to protein; GPI anchor biosynthetic process
Research Articles on Gpaa1
Similar Products
Product Notes
The Gpaa1 gpaa1 (Catalog #AAA7015979) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-621aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gpaa1 gpaa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GLLSDPVRRR ALARIVLRLN TPLCVLSYVA GIAWFLALAF PPLTQRTYMS ENAMGSTMVE EQFVGGDRAR SFARDFAAHR KKPGALPVAW LERSMRSVGL EVYTQSFSRK LPFPDETHER YMVSGTNVYG ILRAPRSAST ESLVLTVPCG PDATNSQAVG LLLALAAHFR GQIYWAKDII FLVTDHDLLG TEAWLEAYHD INVTGIQSSP LQGRAGAIQA AVALELSSDV VTSLDVTVEG LNGQLPNLDL LNLFQTFCQK GGLLCTLQGK LQPQDWTSLE GPLQGLQTLL LMVLRQASGR PHGPHGLFLR YGVEALTLRG INSFRQYKYD LATVGKALEG MFRKLNHLLE RLHQSFFFYL LPALSRFVSI GLYMPATGFL LLVLGLKALE LWMQLHQAGV NPEEAGKAPS PGTPLLPTQG VGLASLTAPL LISQAMGLAL YFLPVLGQHL ATQHFPVAEA EAVVLTLLAI YVAGLALPHN THRVVNSQVP DRGWMALKLV ALIYLALQLG CIALLNFSLG FLLAATMVPA AALAKPHGPR TLYAALLVVT SPAVTLFGSL FLWRELLEVP LSLAEGWQLF LTALAQGVLE HYTYGALLFP ILALGLYPCW LLFWNVLFWK. It is sometimes possible for the material contained within the vial of "Glycosylphosphatidylinositol anchor attachment 1 protein (Gpaa1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
