Envelope glycoprotein (GP) Recombinant Protein | GP recombinant protein
Recombinant Hantaan virus Envelope glycoprotein (GP), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope glycoprotein (GP); Recombinant Hantaan virus Envelope glycoprotein (GP); partial; GP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-485aa; Partial
Sequence
LRNVYDMKIECPHTVSFGENSVIGYVELPPMPLADTAQLVPESSCSMDNHQSLNTITKYTQVSWRGKADQSQSSQTSFETVSTEVDLKGTCVLKHKMVEESYRSRKSITCYDLSCNSTYCKPTLYMIVPIHACNMMKSCLIALGPYRVQVVYERTYCMTGVLIEGKCFVPDQSVVSIIKHGIFDIASVHIVCFFVAVKGNTYKIFEQVKKSFESTCNDTENKVQGYYICIVGGNSAPIYVPTLDDFRSMEAFTGIFRSPHGEDHDLAGEETATYSIVGPANAKVPHSASSDTLSLIAFSGIPSDSSLSILTSSTEAKHVFSPGLFPKLNHTNCDKGAIPLMWTGMIDLPGYYEAIHPCTVFCVLSGPGASCEAFSEGGIFNITYPMCLVSKQNRFRLTEQQVNFVCQRVDVDIVVYCNGQRKVILTKTLVIGQCIYTITSLFSLLPGVAHSIAVELCVPGFHGWATA
Species
Hantaan virus (strain Lee) (Lee virus) (Korean hemorrhagic fever virus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
126,470 Da
NCBI Official Full Name
Envelopment polyprotein
UniProt Protein Name
Envelopment polyprotein
Protein Family
UniProt Gene Name
GP
UniProt Synonym Gene Names
Gc
Uniprot Description
Glycoprotein N and Glycoprotein C interact with each other and are present at the surface of the virion. They are able to attach the virion to host cell receptors. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Also promote fusion of viral membrane with host endosomal membrane after endocytosis of the virion. Gn contains an ITAM motif which is likely to dysregulate normal immune and endothelial cell responses and contribute to virus pathogenesis ().
Similar Products
Product Notes
The GP gp (Catalog #AAA7059782) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-485aa; Partial. The amino acid sequence is listed below: LRNVYDMKIE CPHTVSFGEN SVIGYVELPP MPLADTAQLV PESSCSMDNH QSLNTITKYT QVSWRGKADQ SQSSQTSFET VSTEVDLKGT CVLKHKMVEE SYRSRKSITC YDLSCNSTYC KPTLYMIVPI HACNMMKSCL IALGPYRVQV VYERTYCMTG VLIEGKCFVP DQSVVSIIKH GIFDIASVHI VCFFVAVKGN TYKIFEQVKK SFESTCNDTE NKVQGYYICI VGGNSAPIYV PTLDDFRSME AFTGIFRSPH GEDHDLAGEE TATYSIVGPA NAKVPHSASS DTLSLIAFSG IPSDSSLSIL TSSTEAKHVF SPGLFPKLNH TNCDKGAIPL MWTGMIDLPG YYEAIHPCTV FCVLSGPGAS CEAFSEGGIF NITYPMCLVS KQNRFRLTEQ QVNFVCQRVD VDIVVYCNGQ RKVILTKTLV IGQCIYTITS LFSLLPGVAH SIAVELCVPG FHGWATA . It is sometimes possible for the material contained within the vial of "Envelope glycoprotein (GP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
