N-acetylglucosamine-1-phosphotransferase subunit gamma (Gnptg) Recombinant Protein | Gnptg recombinant protein
Recombinant Mouse N-acetylglucosamine-1-phosphotransferase subunit gamma (Gnptg)
Gene Names
Gnptg; Tce7; Mdcp1; AU067667; AU067744; A830081F19; 6430527N14Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
N-acetylglucosamine-1-phosphotransferase subunit gamma (Gnptg); Recombinant Mouse N-acetylglucosamine-1-phosphotransferase subunit gamma (Gnptg); Gnptg recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-307, full length protein
Sequence
GKMKVVEEPNTFGLNNPFLPQASRLQPKREPSAVSGPLHLFRLAGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIINNTFKGMWMTDGDSCHSRSRQSKVELTCGKINRLAHVSEPSTCVYALTFETPLVCHPHSLLVYPTLSEALQQRWDQVEQDLADELITPQGYEKLLRVLFEDAGYLKVPGETHPTQLAGGSKGLGLETLDNCRKAHAELSQEVQRLTSLLQQHGIPHTQPTETTHSQHLGQQLPIGAIAAEHLRSDPGLRGNIL
Sequence Length
283
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,951 Da
NCBI Official Full Name
N-acetylglucosamine-1-phosphotransferase subunit gamma isoform 2
NCBI Official Synonym Full Names
N-acetylglucosamine-1-phosphotransferase, gamma subunit
NCBI Official Symbol
Gnptg
NCBI Official Synonym Symbols
Tce7; Mdcp1; AU067667; AU067744; A830081F19; 6430527N14Rik
NCBI Protein Information
N-acetylglucosamine-1-phosphotransferase subunit gamma
UniProt Protein Name
N-acetylglucosamine-1-phosphotransferase subunit gamma
Protein Family
UniProt Gene Name
Gnptg
UniProt Synonym Gene Names
Mdcp1
Uniprot Description
Non-catalytic subunit of the N-acetylglucosamine-1-phosphotransferase complex, an enzyme that catalyzes the formation of mannose 6-phosphate (M6P) markers on high mannose type oligosaccharides in the Golgi apparatus. Binds and presents the high mannose glycans of the acceptor to the catalytic alpha and beta subunits (GNPTAB). Enhances the rate of N-acetylglucosamine-1-phosphate transfer to the oligosaccharides of acid hydrolase acceptors.
Research Articles on Gnptg
Similar Products
Product Notes
The Gnptg gnptg (Catalog #AAA1463021) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-307, full length protein. The amino acid sequence is listed below: GKMKVVEEPN TFGLNNPFLP QASRLQPKRE PSAVSGPLHL FRLAGKCFSL VESTYKYEFC PFHNVTQHEQ TFRWNAYSGI LGIWHEWEII NNTFKGMWMT DGDSCHSRSR QSKVELTCGK INRLAHVSEP STCVYALTFE TPLVCHPHSL LVYPTLSEAL QQRWDQVEQD LADELITPQG YEKLLRVLFE DAGYLKVPGE THPTQLAGGS KGLGLETLDN CRKAHAELSQ EVQRLTSLLQ QHGIPHTQPT ETTHSQHLGQ QLPIGAIAAE HLRSDPGLRG NIL. It is sometimes possible for the material contained within the vial of "N-acetylglucosamine-1-phosphotransferase subunit gamma (Gnptg), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
