Guanine nucleotide-binding protein G (I)/G (S)/G (O) subunit gamma-2 (GNG2) Recombinant Protein | GNG2 recombinant protein

Recombinant Human Guanine nucleotide-binding protein G (I)/G (S)/G (O) subunit gamma-2 (GNG2)

Cat. Num. AAA964680

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Guanine nucleotide-binding protein G (I)/G (S)/G (O) subunit gamma-2 (GNG2); Recombinant Human Guanine nucleotide-binding protein G (I)/G (S)/G (O) subunit gamma-2 (GNG2); GNG2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-68, Full length protein
• Sequence: ASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFC
• Sequence Length: 67

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 344313196
• NCBI GeneID: 54331
• NCBI Accession #: NP_001230702.1
• NCBI GenBank Nucleotide #: NM_001243773.1
• UniProt Accession #: P59768; Q5JPE2; Q6P9A9
• Molecular Weight: 7,850 Da
• NCBI Official Full Name: guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
• NCBI Official Synonym Full Names: G protein subunit gamma 2
• NCBI Official Symbol: GNG2
• NCBI Protein Information: guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
• UniProt Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
• UniProt Gene Name: GNG2

NCBI Description

This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules. [provided by RefSeq, Aug 2011]

Uniprot Description

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction ().