Glutaredoxin-related protein 5, mitochondrial (Glrx5) Recombinant Protein | Glrx5 recombinant protein

Recombinant Mouse Glutaredoxin-related protein 5, mitochondrial (Glrx5)

Cat. Num. AAA1337469

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glutaredoxin-related protein 5; mitochondrial (Glrx5); Recombinant Mouse Glutaredoxin-related protein 5; Glrx5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 32-152, full length protein
• Sequence: ASSGGQAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALVDEKDQDSK
• Sequence Length: 121

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 21312153
• NCBI GeneID: 73046
• NCBI Accession #: NP_082695.1
• NCBI GenBank Nucleotide #: NM_028419.3
• UniProt Accession #: Q80Y14; Q3YML1; Q9D6E9
• Molecular Weight: 16,292 Da
• NCBI Official Full Name: glutaredoxin-related protein 5, mitochondrial
• NCBI Official Synonym Full Names: glutaredoxin 5
• NCBI Official Symbol: Glrx5
• NCBI Protein Information: glutaredoxin-related protein 5, mitochondrial
• UniProt Protein Name: Glutaredoxin-related protein 5, mitochondrial
• Protein Family: Glutaredoxin-related protein
• UniProt Gene Name: Glrx5

NCBI Description

This gene encodes a mitochondrial protein, which is evolutionarily conserved. It is involved in the biogenesis of iron-sulfur clusters, which are required for normal iron homeostasis. Mutations in the human gene are associated with autosomal recessive pyridoxine-refractory sideroblastic anemia. [provided by RefSeq, Sep 2015]

Uniprot Description

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (). Involved in protein lipoylation, acting in the pathway that provides an iron-sulfur cluster to lipoate synthase (). Required for normal iron homeostasis (). Required for normal regulation of hemoglobin synthesis by the iron-sulfur protein ACO1 (). May protect cells against apoptosis due to reactive oxygen species and oxidative stress (PubMed:19442627).