Rhomboid protease glpG (glpG) Recombinant Protein | Ent638_3833 recombinant protein
Recombinant Enterobacter sp. Rhomboid protease glpG (glpG)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rhomboid protease glpG (glpG); Recombinant Enterobacter sp. Rhomboid protease glpG (glpG); Recombinant Rhomboid protease glpG (glpG); Rhomboid protease glpG EC= 3.4.21.105; Intramembrane serine protease; Ent638_3833 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-276
Sequence
MLMITSFTNPRVAQAFVDYMATQGVVLTLQQHTQTDVWLADESQAERVNAELARFLENPGDPRYLAASWTNGHMDSGLHYQRFPFFATVRERAGPFTLLLMAACILVFIIMNVVGDQRVMIALAWPYGPAVQYDVWRYFTHALMHFSVLHILFNLLWWWYLGGAVEKRLGSGKLIVITIISALLSGYVQHKFSGPWFGGLSGVVYALMGYAWLRGERDPESGIYMQRGLITFALLWLIAGWFDLFGMSIANGAHVTGLAVGLAMAFADTLNARKRT
Sequence Length
276
Species
Enterobacter sp. (strain 638)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,007 Da
NCBI Official Full Name
intramembrane serine protease GlpG
NCBI Official Symbol
Ent638_3833
NCBI Protein Information
intramembrane serine protease GlpG
UniProt Protein Name
Rhomboid protease GlpG
UniProt Gene Name
glpG
UniProt Entry Name
GLPG_ENT38
Uniprot Description
Function: Rhomboid-type serine protease that catalyzes intramembrane proteolysis
By similarity. HAMAP-Rule MF_01594
Catalytic activity: Cleaves type-1 transmembrane domains using a catalytic dyad composed of serine and histidine that are contributed by different transmembrane domains. HAMAP-Rule MF_01594
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01594.
Sequence similarities: Belongs to the peptidase S54 family.
Similar Products
Product Notes
The Ent638_3833 glpg (Catalog #AAA1200439) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-276. The amino acid sequence is listed below: MLMITSFTNP RVAQAFVDYM ATQGVVLTLQ QHTQTDVWLA DESQAERVNA ELARFLENPG DPRYLAASWT NGHMDSGLHY QRFPFFATVR ERAGPFTLLL MAACILVFII MNVVGDQRVM IALAWPYGPA VQYDVWRYFT HALMHFSVLH ILFNLLWWWY LGGAVEKRLG SGKLIVITII SALLSGYVQH KFSGPWFGGL SGVVYALMGY AWLRGERDPE SGIYMQRGLI TFALLWLIAG WFDLFGMSIA NGAHVTGLAV GLAMAFADTL NARKRT. It is sometimes possible for the material contained within the vial of "Rhomboid protease glpG (glpG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
