Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glycerol uptake facilitator protein (glpF) Recombinant Protein | glpF recombinant protein

Recombinant Escherichia coli Glycerol uptake facilitator protein (glpF)

Gene Names
glpF; ECK3919; JW3898
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycerol uptake facilitator protein (glpF); Recombinant Escherichia coli Glycerol uptake facilitator protein (glpF); Recombinant Glycerol uptake facilitator protein (glpF); Glycerol uptake facilitator protein; Aquaglyceroporin; glpF recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-281
Sequence
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGPIVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL
Sequence Length
281
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,780 Da
NCBI Official Full Name
glycerol facilitator
NCBI Official Symbol
glpF
NCBI Official Synonym Symbols
ECK3919; JW3898
NCBI Protein Information
glycerol facilitator
UniProt Protein Name
Glycerol uptake facilitator protein
UniProt Gene Name
glpF
UniProt Entry Name
GLPF_ECOLI

NCBI Description

The glycerol facilitator, GlpF, allows the facilitated diffusion of glycerol across the inner membrane for utilization inside the cell. [More information is available at EcoCyc: EG10396].

Uniprot Description

Function: Transporter of glycerol across the cytoplasmic membrane, with limited permeability to water and small uncharged compounds such as polyols.

Cofactor: Binds 2 magnesium ions per subunit.

Subunit structure: Homotetramer

Potential.

Subcellular location: Cell inner membrane; Multi-pass membrane protein Ref.9.

Domain: Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).

Miscellaneous: The remarkable property of effective water conductance combined with a strict exclusion of all ions including protons is mediated by two conserved asparagines which force a central water molecule to serve strictly as a hydrogen bond donor to its neighboring water molecules. Assisted by the electrostatic potential generated by two half-membrane spanning loops, this dictates opposite orientations of water molecules in the two halves of the channel, and thus prevents the formation of a "proton wire", while permitting rapid water diffusion.

Sequence similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family. [View classification]

Research Articles on glpF

Similar Products

Product Notes

The glpF glpf (Catalog #AAA1252512) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-281. The amino acid sequence is listed below: MSQTSTLKGQ CIAEFLGTGL LIFFGVGCVA ALKVAGASFG QWEISVIWGL GVAMAIYLTA GVSGAHLNPA VTIALWLFAC FDKRKVIPFI VSQVAGAFCA AALVYGLYYN LFFDFEQTHH IVRGSVESVD LAGTFSTYPN PHINFVQAFA VEMVITAILM GLILALTDDG NGVPRGPLAP LLIGLLIAVI GASMGPLTGF AMNPARDFGP KVFAWLAGWG NVAFTGGRDI PYFLVPLFGP IVGAIVGAFA YRKLIGRHLP CDICVVEEKE TTTPSEQKAS L. It is sometimes possible for the material contained within the vial of "Glycerol uptake facilitator protein (glpF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.