Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Carbonic anhydrase 1 Recombinant Protein | Ca1 recombinant protein

Recombinant Rat Carbonic anhydrase 1

Gene Names
Car1; Ca1; CA-I
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbonic anhydrase 1; Recombinant Rat Carbonic anhydrase 1; Carbonate dehydratase I; Ca1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-261
Sequence
ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRT
Sequence Length
261
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for Ca1 recombinant protein
Reversible hydration of carbon dioxide. Curated
References
Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome profile of the mature rat olfactory bulb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599(2009)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.3kD
NCBI Official Full Name
carbonic anhydrase 1
NCBI Official Synonym Full Names
carbonic anhydrase I
NCBI Official Symbol
Car1
NCBI Official Synonym Symbols
Ca1; CA-I
NCBI Protein Information
carbonic anhydrase 1
UniProt Protein Name
Carbonic anhydrase 1
Protein Family
UniProt Gene Name
Ca1
UniProt Synonym Gene Names
CA-I
UniProt Entry Name
CAH1_RAT

Uniprot Description

CA1: Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea. Belongs to the alpha-carbonic anhydrase family.

Protein type: Lyase; Energy Metabolism - nitrogen; EC 4.2.1.1

Cellular Component: cytoplasm

Molecular Function: arylesterase activity; carbonate dehydratase activity; hydro-lyase activity; zinc ion binding

Biological Process: one-carbon compound metabolic process

Research Articles on Ca1

Similar Products

Product Notes

The Ca1 ca1 (Catalog #AAA969482) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-261. The amino acid sequence is listed below: ASADWGYDSK NGPDQWSKLY PIANGNNQSP IDIKTSEAKH DSSLKPVSVS YNPATAKEIV NVGHSFHVVF DDSSNQSVLK GGPLADSYRL TQFHFHWGNS NDHGSEHTVD GAKYSGELHL VHWNSAKYSS AAEAISKADG LAIIGVLMKV GPANPNLQKV LDALSSVKTK GKRAPFTNFD PSSLLPSSLD YWTYFGSLTH PPLHESVTWV ICKESISLSP EQLAQLRGLL SSAEGEPAVP VLSNHRPPQP LKGRT. It is sometimes possible for the material contained within the vial of "Carbonic anhydrase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.