GLIPR1-like protein 2 (Glipr1l2) Recombinant Protein | Glipr1l2 recombinant protein
Recombinant Mouse GLIPR1-like protein 2 (Glipr1l2)
Gene Names
Glipr1l2; 4921508O11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GLIPR1-like protein 2 (Glipr1l2); Recombinant Mouse GLIPR1-like protein 2 (Glipr1l2); Glipr1l2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-332aa; full length protein
Sequence
MKASLPWSVVWRAQSNYVRLRRVLKLCELWLLLVGSGLNAKLPLEEDVDFINEYVGLHNE LRGTVFPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEIGENMWVG PVEDFTVTTAIRSWHEERKSYSYLNDTCVEDQNCSHYIQLVWDSSYKVGCAVTSCARAGG FTHAALFICNYAPGGTLTRRPYQAGQFCSRCGPGDQCTDYLCSNTVRDEATYYQFWYPPW EKPRPVVCNPMCIFILFLRVASLLLCVIVVLIVQSRFPVILMETPTIISAEEEGKTEVEI VMEEGEGEGEGGEGEGEGEEKEEEEMLEEDEQ
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Glipr1l2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,702 Da
NCBI Official Full Name
GLIPR1-like protein 2
NCBI Official Synonym Full Names
GLI pathogenesis-related 1 like 2
NCBI Official Symbol
Glipr1l2
NCBI Official Synonym Symbols
4921508O11Rik
NCBI Protein Information
GLIPR1-like protein 2
UniProt Protein Name
GLIPR1-like protein 2
Protein Family
UniProt Gene Name
Glipr1l2
UniProt Entry Name
GRPL2_MOUSE
Uniprot Description
GLIPR1L2: a member of the cysteine-rich secretory protein, antigen 5, and pathogenesis-related 1 superfamily. Members of this family have roles in a variety of processes, including cancer and immune defense. This gene is located in a cluster with two related genes on chromosome 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
Protein type: Membrane protein, integral
Cellular Component: integral to membrane; membrane
Research Articles on Glipr1l2
Similar Products
Product Notes
The Glipr1l2 glipr1l2 (Catalog #AAA7015782) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-332aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Glipr1l2 glipr1l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKASLPWSVV WRAQSNYVRL RRVLKLCELW LLLVGSGLNA KLPLEEDVDF INEYVGLHNE LRGTVFPPGV NLRFMTWDVA LSRTARAWGK KCMYSRNTHL DKLHESHPVF TEIGENMWVG PVEDFTVTTA IRSWHEERKS YSYLNDTCVE DQNCSHYIQL VWDSSYKVGC AVTSCARAGG FTHAALFICN YAPGGTLTRR PYQAGQFCSR CGPGDQCTDY LCSNTVRDEA TYYQFWYPPW EKPRPVVCNP MCIFILFLRV ASLLLCVIVV LIVQSRFPVI LMETPTIISA EEEGKTEVEI VMEEGEGEGE GGEGEGEGEE KEEEEMLEED EQ. It is sometimes possible for the material contained within the vial of "GLIPR1-like protein 2 (Glipr1l2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
