Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gap junction beta-6 protein (GJB6) Recombinant Protein | GJB6 recombinant protein

Recombinant Chicken Gap junction beta-6 protein (GJB6)

Gene Names
GJB6; CX31
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gap junction beta-6 protein (GJB6); Recombinant Chicken Gap junction beta-6 protein (GJB6); Recombinant Gap junction beta-6 protein (GJB6); Gap junction beta-6 protein; Connexin-31; Cx31; GJB6 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-263
Sequence
MDWGALQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAERVWGDEQDDFICNTLQPGCKNVCYDHFFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRQFRKGDQKCEYKDIEEIRTQRFRIEGTLWWTYTCSIFFRLVFEAVFMYAFYFMYDGFRMPRLMKCSAWPCPNTVDCFVSRPTEKTVFTIFMIAVSSICILLNVAELCYLLTKFFLRRSRKAGNQKHHPNHENKEETKQNEMNELISDSCQNTVIGFTSS
Sequence Length
263
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,923 Da
NCBI Official Full Name
gap junction beta-6 protein
NCBI Official Symbol
GJB6
NCBI Official Synonym Symbols
CX31
NCBI Protein Information
gap junction beta-6 protein; connexin 31; connexin-31; gap junction protein, beta 6 (connexin 30)
UniProt Protein Name
Gap junction beta-6 protein
UniProt Gene Name
GJB6
UniProt Synonym Gene Names
Cx31
UniProt Entry Name
CXB6_CHICK

Uniprot Description

Function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell

By similarity.

Subunit structure: A connexon is composed of a hexamer of connexins

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity. Cell junction › gap junction

By similarity.

Tissue specificity: Exclusively expressed in the cochlea of the inner ear, where it is found in cells of the tegmentum vasculosum, cuboidal cells, supporting cells and clear cells. Ref.1

Developmental stage: Specifically expressed at the late developmental stages in the cochlea. Ref.1

Sequence similarities: Belongs to the connexin family. Beta-type (group I) subfamily. UniProtKB O95452

Research Articles on GJB6

Similar Products

Product Notes

The GJB6 gjb6 (Catalog #AAA1258045) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-263. The amino acid sequence is listed below: MDWGALQTIL GGVNKHSTSI GKIWLTVLFI FRIMILVVAA ERVWGDEQDD FICNTLQPGC KNVCYDHFFP ISHIRLWALQ LIFVSTPALL VAMHVAYRRH EKKRQFRKGD QKCEYKDIEE IRTQRFRIEG TLWWTYTCSI FFRLVFEAVF MYAFYFMYDG FRMPRLMKCS AWPCPNTVDC FVSRPTEKTV FTIFMIAVSS ICILLNVAEL CYLLTKFFLR RSRKAGNQKH HPNHENKEET KQNEMNELIS DSCQNTVIGF TSS. It is sometimes possible for the material contained within the vial of "Gap junction beta-6 protein (GJB6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.