Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gap junction alpha-4 protein (GJA4) Recombinant Protein | GJA4 recombinant protein

Recombinant Human Gap junction alpha-4 protein (GJA4)

Gene Names
GJA4; CX37
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gap junction alpha-4 protein (GJA4); Recombinant Human Gap junction alpha-4 protein (GJA4); Recombinant Gap junction alpha-4 protein (GJA4); Gap junction alpha-4 protein; Connexin-37; Cx37; GJA4 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-333
Sequence
GDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
Sequence Length
333
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,414 Da
NCBI Official Full Name
gap junction alpha-4 protein
NCBI Official Synonym Full Names
gap junction protein, alpha 4, 37kDa
NCBI Official Symbol
GJA4
NCBI Official Synonym Symbols
CX37
NCBI Protein Information
gap junction alpha-4 protein; connexin 37; connexin-37
UniProt Protein Name
Gap junction alpha-4 protein
UniProt Gene Name
GJA4
UniProt Synonym Gene Names
Cx37
UniProt Entry Name
CXA4_HUMAN

NCBI Description

This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. [provided by RefSeq, Jul 2008]

Uniprot Description

GJA4: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Belongs to the connexin family. Alpha-type (group II) subfamily.

Protein type: Cell adhesion; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p35.1

Cellular Component: connexon complex; integral to plasma membrane; gap junction

Molecular Function: protein binding

Biological Process: blood vessel development; intercellular junction assembly; cell-cell signaling; transport; calcium ion transport; response to pain

Research Articles on GJA4

Similar Products

Product Notes

The GJA4 gja4 (Catalog #AAA968682) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-333. The amino acid sequence is listed below: GDWGFLEKLL DQVQEHSTVV GKIWLTVLFI FRILILGLAG ESVWGDEQSD FECNTAQPGC TNVCYDQAFP ISHIRYWVLQ FLFVSTPTLV YLGHVIYLSR REERLRQKEG ELRALPAKDP QVERALAAVE RQMAKISVAE DGRLRIRGAL MGTYVASVLC KSVLEAGFLY GQWRLYGWTM EPVFVCQRAP CPYLVDCFVS RPTEKTIFII FMLVVGLISL VLNLLELVHL LCRCLSRGMR ARQGQDAPPT QGTSSDPYTD QVFFYLPVGQ GPSSPPCPTY NGLSSSEQNW ANLTTEERLA SSRPPLFLDP PPQNGQKPPS RPSSSASKKQ YV. It is sometimes possible for the material contained within the vial of "Gap junction alpha-4 protein (GJA4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.