Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Growth hormone secretagogue receptor type 1 (Ghsr) Recombinant Protein | Ghsr recombinant protein

Recombinant Rat Growth hormone secretagogue receptor type 1 (Ghsr)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Growth hormone secretagogue receptor type 1 (Ghsr); Recombinant Rat Growth hormone secretagogue receptor type 1 (Ghsr); Ghsr recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-364aa; full length protein
Sequence
MWNATPSEEPEPNVTLDLDWDASPGNDSLPDELLPLFPAPLLAGVTATCVALFVVGISGN LLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQF VSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVL VGVEHENGTDPRDTNECRATEFAVRSGLLTVMVWVSSVFFFLPVFCLTVLYSLIGRKLWR RRGDAAVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQISQ YCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFKLLGFESFSQRKLSTLKDESSRAWTKS SINT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ghsr recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,963 Da
NCBI Official Full Name
growth hormone secretagogue receptor type 1
NCBI Official Synonym Full Names
growth hormone secretagogue receptor
NCBI Official Symbol
Ghsr
NCBI Protein Information
growth hormone secretagogue receptor type 1
UniProt Protein Name
Growth hormone secretagogue receptor type 1
UniProt Gene Name
Ghsr
UniProt Synonym Gene Names
GHS-R; GHRP
UniProt Entry Name
GHSR_RAT

NCBI Description

has G-protein coupled receptor binding activity to ligand ghrelin; plays a role in regulation of growth hormone release [RGD, Feb 2006]

Uniprot Description

GHSR: Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine). Defects in GHSR may be a cause of idiopathic short stature autosomal (ISSA). Short stature is defined by a subnormal rate of growth. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1

Cellular Component: cell surface; integral to membrane; lipid raft; neuron projection; plasma membrane

Molecular Function: G-protein coupled receptor activity; growth hormone receptor binding; growth hormone secretagogue receptor activity; growth hormone-releasing hormone receptor activity; hormone binding; peptide hormone binding; protein binding

Biological Process: actin polymerization and/or depolymerization; adult feeding behavior; cellular response to insulin stimulus; decidualization; G-protein coupled receptor protein signaling pathway; growth hormone secretion; hormone-mediated signaling; negative regulation of inflammatory response; negative regulation of insulin secretion; negative regulation of interleukin-1 beta production; negative regulation of interleukin-6 biosynthetic process; negative regulation of tumor necrosis factor biosynthetic process; positive regulation of appetite; positive regulation of fatty acid metabolic process; positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of multicellular organism growth; regulation of hindgut contraction; regulation of synaptogenesis; response to food; response to hormone stimulus

Research Articles on Ghsr

Similar Products

Product Notes

The Ghsr ghsr (Catalog #AAA7015647) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-364aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ghsr ghsr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWNATPSEEP EPNVTLDLDW DASPGNDSLP DELLPLFPAP LLAGVTATCV ALFVVGISGN LLTMLVVSRF RELRTTTNLY LSSMAFSDLL IFLCMPLDLV RLWQYRPWNF GDLLCKLFQF VSESCTYATV LTITALSVER YFAICFPLRA KVVVTKGRVK LVILVIWAVA FCSAGPIFVL VGVEHENGTD PRDTNECRAT EFAVRSGLLT VMVWVSSVFF FLPVFCLTVL YSLIGRKLWR RRGDAAVGAS LRDQNHKQTV KMLAVVVFAF ILCWLPFHVG RYLFSKSFEP GSLEIAQISQ YCNLVSFVLF YLSAAINPIL YNIMSKKYRV AVFKLLGFES FSQRKLSTLK DESSRAWTKS SINT. It is sometimes possible for the material contained within the vial of "Growth hormone secretagogue receptor type 1 (Ghsr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.