Growth hormone-releasing hormone receptor (GHRHR) Recombinant Protein | GHRHR recombinant protein
Recombinant Pig Growth hormone-releasing hormone receptor (GHRHR)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Growth hormone-releasing hormone receptor (GHRHR); Recombinant Pig Growth hormone-releasing hormone receptor (GHRHR); Recombinant Growth hormone-releasing hormone receptor (GHRHR); Growth hormone-releasing hormone receptor; GHRH receptor; Growth hormone-releasing factor receptor; GRF receptor; GRFR; GHRHR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-130; Fragment at the N-terminal, provide the extracellular domain at the N-terminal.
Sequence
HVHPECDFITQLREDERTCLQAADRMANSSSGCPRTWDGLLCWPTAGPGEWVTLPCPAFFSHFSSEPGALKRDCTTTGWSEPFPPYPEACPVPLELLTDEKSYFSTVR
Sequence Length
130
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,200 Da
NCBI Official Full Name
growth hormone-releasing hormone receptor
NCBI Official Symbol
GHRHR
NCBI Protein Information
growth hormone-releasing hormone receptor; GRFR; GRF receptor; GHRH receptor; growth hormone-releasing factor receptor; growth hormone-releasing hormone receptor precursor variant 1
UniProt Protein Name
Growth hormone-releasing hormone receptor
Protein Family
UniProt Gene Name
GHRHR
UniProt Synonym Gene Names
GHRH receptor; GRF receptor; GRFR
UniProt Entry Name
GHRHR_PIG
Uniprot Description
Function: Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Tissue specificity: Pituitary gland. Also detected in the lymphocytes and thymocytes.
Sequence similarities: Belongs to the G-protein coupled receptor 2 family.
Research Articles on GHRHR
Similar Products
Product Notes
The GHRHR ghrhr (Catalog #AAA949183) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-130; Fragment at the N-terminal, provide the extracellular domain at the N-terminal. The amino acid sequence is listed below: HVHPECDFIT QLREDERTCL QAADRMANSS SGCPRTWDGL LCWPTAGPGE WVTLPCPAFF SHFSSEPGAL KRDCTTTGWS EPFPPYPEAC PVPLELLTDE KSYFSTVR . It is sometimes possible for the material contained within the vial of "Growth hormone-releasing hormone receptor (GHRHR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
