Envelope glycoprotein H (gH) Recombinant Protein | gH recombinant protein
Recombinant Epstein-Barr virus Envelope glycoprotein H (gH)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope glycoprotein H (gH); Recombinant Epstein-Barr virus Envelope glycoprotein H (gH); gH recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
19-706aa; full length protein
Sequence
SLSEVKLHLDIEGHASHYTIPWTELMAKVPGLSPEALWREANVTEDLASMLNRYKLIYKT SGTLGIALAEPVDIPAVSEGSMQVDASKVHPGVISGLNSPACMLSAPLEKQLFYYIGTML PNTRPHSYVFYQLRCHLSYVALSINGDKFQYTGAMTSKFLMGTYKRVTEKGDEHVLSLIF GKTKDLPDLRGPFSYPSLTSAQSGDYSLVIVTTFVHYANFHNYFVPNLKDMFSRAVTMTA ASYARYVLQKLVLLEMKGGCREPELDTETLTTMFEVSVAFFKVGHAVGETGNGCVDLRWL AKSFFELTVLKDIIGICYGATVKGMQSYGLERLAAVLMATVKMEELGHLTTEKQEYALRL ATVGYPKAGVYSGLIGGATSVLLSAYNRHPLFQPLHTVMRETLFIGSHVVLRELRLNVTT QGPNLALYQLLSTALCSALEIGEVLRGLALGTESGLFSPCYLSLRFDLTRDKLLSMAPQE AMLDQAAVSNAVDGFLGRLSLEREDRDAWHLPAYKCVDRLDKVLMIIPLINVTFIISSDR EVRGSALYEASTTYLSSSLFLSPVIMNKCSQGAVAGEPRQIPKIQNFTRTQKSCIFCGFA LLSYDEKEGLETTTYITSQEVQNSILSSNYFDFDNLHVHYLLLTTNGTVMEIAGLYEERA HVVLAIILYFIAFALGIFLVHKIVMFFL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for gH recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,334 Da
NCBI Official Full Name
BXLF2
NCBI Official Symbol
HHV4tp2_gp61
NCBI Protein Information
envelope glycoprotein gH; gp85
UniProt Protein Name
Envelope glycoprotein H
Protein Family
UniProt Gene Name
gH
UniProt Synonym Gene Names
gH; gp85
UniProt Entry Name
GH_EBVA8
Uniprot Description
The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Following initial binding to host receptor, membrane fusion is mediated by the fusion machinery composed of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.
Research Articles on gH
Similar Products
Product Notes
The gH gh (Catalog #AAA7015623) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-706aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the gH gh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SLSEVKLHLD IEGHASHYTI PWTELMAKVP GLSPEALWRE ANVTEDLASM LNRYKLIYKT SGTLGIALAE PVDIPAVSEG SMQVDASKVH PGVISGLNSP ACMLSAPLEK QLFYYIGTML PNTRPHSYVF YQLRCHLSYV ALSINGDKFQ YTGAMTSKFL MGTYKRVTEK GDEHVLSLIF GKTKDLPDLR GPFSYPSLTS AQSGDYSLVI VTTFVHYANF HNYFVPNLKD MFSRAVTMTA ASYARYVLQK LVLLEMKGGC REPELDTETL TTMFEVSVAF FKVGHAVGET GNGCVDLRWL AKSFFELTVL KDIIGICYGA TVKGMQSYGL ERLAAVLMAT VKMEELGHLT TEKQEYALRL ATVGYPKAGV YSGLIGGATS VLLSAYNRHP LFQPLHTVMR ETLFIGSHVV LRELRLNVTT QGPNLALYQL LSTALCSALE IGEVLRGLAL GTESGLFSPC YLSLRFDLTR DKLLSMAPQE AMLDQAAVSN AVDGFLGRLS LEREDRDAWH LPAYKCVDRL DKVLMIIPLI NVTFIISSDR EVRGSALYEA STTYLSSSLF LSPVIMNKCS QGAVAGEPRQ IPKIQNFTRT QKSCIFCGFA LLSYDEKEGL ETTTYITSQE VQNSILSSNY FDFDNLHVHY LLLTTNGTVM EIAGLYEERA HVVLAIILYF IAFALGIFLV HKIVMFFL. It is sometimes possible for the material contained within the vial of "Envelope glycoprotein H (gH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
