SDS-PAGE
Envelope glycoprotein G Recombinant Protein | US4 recombinant protein
Recombinant Human herpesvirus 1 Envelope glycoprotein G
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope glycoprotein G; Recombinant Human herpesvirus 1 Envelope glycoprotein G; gG-1; US4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-189. Partial
Sequence
VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALD
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for US4 recombinant protein
Chokine-binding protein that inhibits neutrophils' chemotaxis.
References
Sequence determination and genetic content of the short unique region in the genome of herpes simplex virus type 1.McGeoch D.J., Dolan A., Donald S., Rixon F.J.J. Mol. Biol. 181:1-13(1985)
The DNA sequences of the long repeat region and adjoining parts of the long unique region in the genome of herpes simplex virus type 1.Perry L.J., McGeoch D.J.J. Gen. Virol. 69:2831-2846(1988)
Variability of the glycoprotein G gene in clinical isolates of herpes simplex virus type 1.Rekabdar E., Tunback P., Liljeqvist J.-A., Bergstroem T.Clin. Diagn. Lab. Immunol. 6:826-831(1999)
Patterns of Eurasian HSV-1 molecular diversity and inferences of human migrations.Bowden R., Sakaoka H., Ward R., Donnelly P.Infect. Genet. Evol. 6:63-74(2006)
Determination and analysis of the DNA sequence of highly attenuated herpes simplex virus type 1 mutant HF10, a potential oncolytic virus.Ushijima Y., Luo C., Goshima F., Yamauchi Y., Kimura H., Nishiyama Y.Microbes Infect. 9:142-149(2007)
Herpes simplex virus type 1 bacterial artificial chromosome.Cunningham C., Davison A.J. Comprehensive characterization of extracellular herpes simplex virus type 1 virions.Loret S., Guay G., Lippe R.J. Virol. 82:8605-8618(2008)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33.4 kDa
NCBI Official Full Name
envelope glycoprotein G
NCBI Official Symbol
US4
UniProt Protein Name
Envelope glycoprotein G
Protein Family
UniProt Gene Name
gG
UniProt Synonym Gene Names
gG
UniProt Entry Name
GG_HHV11
Uniprot Description
Chemokine-binding protein that inhibits neutrophils' chemotaxis.
Research Articles on US4
Similar Products
Product Notes
The US4 gg (Catalog #AAA1070253) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-189. Partial. The amino acid sequence is listed below: VPTNVSSTTQ PQLQTTGRPS HEAPNMTQTG TTDSPTAISL TTPDHTPPMP SIGLEEEEEE EGAGDGEHLE GGDGTRDTLP QSPGPAFPLA EDVEKDKPNR PVVPSPDPNN SPARPETSRP KTPPTIIGPL ATRPTTRLTS KGRPLVPTPQ HTPLFSFLTA SPALD . It is sometimes possible for the material contained within the vial of "Envelope glycoprotein G, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
