Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GDNF family receptor alpha-3 (GFRA3) Recombinant Protein | GFRA3 recombinant protein

Recombinant Human GDNF family receptor alpha-3 (GFRA3)

Gene Names
GFRA3; GDNFR3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GDNF family receptor alpha-3 (GFRA3); Recombinant Human GDNF family receptor alpha-3 (GFRA3); GFRA3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
32-374, Full length protein
Sequence
DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNEN
Sequence Length
343
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GFRA3 recombinant protein
This protein is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,930 Da
NCBI Official Full Name
GDNF family receptor alpha-3 preproprotein
NCBI Official Synonym Full Names
GDNF family receptor alpha 3
NCBI Official Symbol
GFRA3
NCBI Official Synonym Symbols
GDNFR3
NCBI Protein Information
GDNF family receptor alpha-3
UniProt Protein Name
GDNF family receptor alpha-3
Protein Family
UniProt Gene Name
GFRA3
UniProt Synonym Gene Names
GDNF receptor alpha-3; GDNFR-alpha-3; GFR-alpha-3

NCBI Description

The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin. [provided by RefSeq, Jul 2008]

Uniprot Description

Receptor for the glial cell line-derived neurotrophic factor, ARTN (artemin). Mediates the artemin-induced autophosphorylation and activation of the RET receptor tyrosine kinase.

Research Articles on GFRA3

Similar Products

Product Notes

The GFRA3 gfra3 (Catalog #AAA1073689) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-374, Full length protein. The amino acid sequence is listed below: DPLPTESRLM NSCLQARRKC QADPTCSAAY HHLDSCTSSI STPLPSEEPS VPADCLEAAQ QLRNSSLIGC MCHRRMKNQV ACLDIYWTVH RARSLGNYEL DVSPYEDTVT SKPWKMNLSK LNMLKPDSDL CLKFAMLCTL NDKCDRLRKA YGEACSGPHC QRHVCLRQLL TFFEKAAEPH AQGLLLCPCA PNDRGCGERR RNTIAPNCAL PPVAPNCLEL RRLCFSDPLC RSRLVDFQTH CHPMDILGTC ATEQSRCLRA YLGLIGTAMT PNFVSNVNTS VALSCTCRGS GNLQEECEML EGFFSHNPCL TEAIAAKMRF HSQLFSQDWP HPTFAVMAHQ NEN. It is sometimes possible for the material contained within the vial of "GDNF family receptor alpha-3 (GFRA3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.