GDNF family receptor alpha-2 (Gfra2) Recombinant Protein | Gfra2 recombinant protein
Recombinant Mouse GDNF family receptor alpha-2 (Gfra2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GDNF family receptor alpha-2 (Gfra2); Recombinant Mouse GDNF family receptor alpha-2 (Gfra2); Gfra2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-443, Full length protein
Sequence
SPSSPQGSELHGWRPQVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRSLCRTDHLCRSRLADFHANCRASYRTITSCPADNYQACLGSYAGMIGFDMTPNYVDSNPTGIVVSPWCNCRGSGNMEEECEKFLKDFTENPCLRNAIQAFGNGTDVNMSPKGPTFSATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSIQEQGLKANNSKELSMCFTELTTNISPGSKKVIKLYSGS
Sequence Length
422
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gfra2 recombinant protein
Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. This protein is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1. This gene is a candidate gene for RET-associated diseases. Multiple transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,827 Da
NCBI Official Full Name
GDNF family receptor alpha-2 isoform 2
NCBI Official Synonym Full Names
glial cell line derived neurotrophic factor family receptor alpha 2
NCBI Official Symbol
Gfra2
NCBI Protein Information
GDNF family receptor alpha-2
UniProt Protein Name
GDNF family receptor alpha-2
Protein Family
UniProt Gene Name
Gfra2
UniProt Synonym Gene Names
GDNF receptor alpha-2; GDNFR-alpha-2; GFR-alpha-2; GDNFR-beta; NRTNR-alpha; NTNR-alpha
NCBI Description
The protein encoded by this gene is part of the receptor complex that transduces glial cell-derived neurotrophic factor and neurturin signals by mediating autophosphorylation and activation of the RET receptor. Mice lacking this protein are viable and fertile but display growth retardation attributed to impaired salivary and pancreatic secretion and innervation deficits in the intestinal tract. In addition, knockout mice display neural defects including a failure to initiate outgrowth of dorsal ganglion root neurons, demonstrating a requirement in neuronal differentiation of these cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]
Uniprot Description
Receptor for neurturin. Mediates the NRTN-induced autophosphorylation and activation of the RET receptor. Also able to mediate GDNF signaling through the RET tyrosine kinase receptor.
Research Articles on Gfra2
Similar Products
Product Notes
The Gfra2 gfra2 (Catalog #AAA1033434) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-443, Full length protein. The amino acid sequence is listed below: SPSSPQGSEL HGWRPQVDCV RANELCAAES NCSSRYRTLR QCLAGRDRNT MLANKECQAA LEVLQESPLY DCRCKRGMKK ELQCLQIYWS IHLGLTEGEE FYEASPYEPV TSRLSDIFRL ASIFSGTGAD PVVSAKSNHC LDAAKACNLN DNCKKLRSSY ISICNREISP TERCNRRKCH KALRQFFDRV PSEYTYRMLF CSCQDQACAE RRRQTILPSC SYEDKEKPNC LDLRSLCRTD HLCRSRLADF HANCRASYRT ITSCPADNYQ ACLGSYAGMI GFDMTPNYVD SNPTGIVVSP WCNCRGSGNM EEECEKFLKD FTENPCLRNA IQAFGNGTDV NMSPKGPTFS ATQAPRVEKT PSLPDDLSDS TSLGTSVITT CTSIQEQGLK ANNSKELSMC FTELTTNISP GSKKVIKLYS GS. It is sometimes possible for the material contained within the vial of "GDNF family receptor alpha-2 (Gfra2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
