Zinc finger protein Gfi-1 (GFI1) Recombinant Protein | GFI1 recombinant protein

Recombinant Dog Zinc finger protein Gfi-1 (GFI1)

Cat. Num. AAA1417527

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Zinc finger protein Gfi-1 (GFI1); Recombinant Dog Zinc finger protein Gfi-1 (GFI1); GFI1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-422, Full length protein
• Sequence: MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVLAPGGADGTSSAGGAQTEPRGRLSPESQLTEAPDRSSASPGSCEGSVCDRSSEFEDFWRPPSPSVSPASEKSVCPSLDEAQPFPLPFKPYSWRGLAGSDLRHLVHSYRPCAALDRGAGLGLFCERAPEPGHPAALYGPERAAGGAGAGAPGGGSAGGGAAGGSGLGLYGDFGPAAAGLYERPTAAAGGLYSERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK
• Sequence Length: 422

• Species: Canis familiaris (Dog) (Canis lupus familiaris)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for GFI1 recombinant protein

This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 60678286
• NCBI GeneID: 490156
• NCBI Accession #: NP_001012737.1
• NCBI GenBank Nucleotide #: NM_001012719.1
• UniProt Accession #: Q5DWN0
• Molecular Weight: 44,977 Da
• NCBI Official Full Name: zinc finger protein Gfi-1
• NCBI Official Synonym Full Names: growth factor independent 1 transcriptional repressor
• NCBI Official Symbol: GFI1
• NCBI Protein Information: zinc finger protein Gfi-1
• UniProt Protein Name: Zinc finger protein Gfi-1
• Protein Family: Zinc finger protein
• UniProt Gene Name: GFI1

Uniprot Description

Transcription repressor essential for hematopoiesis. Functions in a cell-context and development-specific manner. Binds to 5'-TAAATCAC[AT]GCA-3' in the promoter region of a large number of genes. Component of several complexes, including the EHMT2-GFI1-HDAC1, AJUBA-GFI1-HDAC1 and RCOR-GFI-KDM1A-HDAC complexes, that suppress, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Regulates neutrophil differentiation, promotes proliferation of lymphoid cells, and is required for granulocyte development. Mediates, together with U2AF1L4, the alternative splicing of CD45 and controls T-cell receptor signaling. Regulates the endotoxin-mediated Toll-like receptor (TLR) inflammatory response by antagonizing RELA. Cooperates with CBFA2T2 to regulate ITGB1-dependent neurite growth. Controls cell-cycle progression by repressing CDKNIA/p21 transcription in response to TGFB1 via recruitment of GFI1 by ZBTB17 to the CDKNIA/p21 and CDKNIB promoters. Required for the maintenance of inner ear hair cells ().