Gem-associated protein 6 (Gemin6) Recombinant Protein | Gemin6 recombinant protein

Recombinant Mouse Gem-associated protein 6 (Gemin6)

Cat. Num. AAA1446475

• Gene Names: Gemin6; 2610019B15Rik; 2810470M17Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Gem-associated protein 6 (Gemin6); Recombinant Mouse Gem-associated protein 6 (Gemin6); Gemin6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-166, full length protein
• Sequence: MSEWMKKSPLEWEDYVYKEVRVIACEKEYKGWLLTTDPVSANIVLVNFLEDGRLSVTGIMGHSVQTVETISEGDHRVREKLMHVFASGDCKGYSPEDLEEKRTSLKKWLEKNHIPVTEQGDAQRTLCVAGVLTIDPPYAPENCSSSNEIILSRIQDLIQGHLSASQ
• Sequence Length: 166

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 21313050
• NCBI GeneID: 67242
• NCBI Accession #: NP_080329.1
• NCBI GenBank Nucleotide #: NM_026053.4
• UniProt Accession #: Q9CX53; Q3TIW7; Q9CQI0; Q9CXC5
• Molecular Weight: 18,750 Da
• NCBI Official Full Name: gem-associated protein 6
• NCBI Official Synonym Full Names: gem nuclear organelle associated protein 6
• NCBI Official Symbol: Gemin6
• NCBI Official Synonym Symbols: 2610019B15Rik; 2810470M17Rik
• NCBI Protein Information: gem-associated protein 6
• UniProt Protein Name: Gem-associated protein 6
• Protein Family: Gem-associated protein
• UniProt Gene Name: Gemin6
• UniProt Synonym Gene Names: Gemin-6

Uniprot Description

The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus ().