Fibroblast Growth Factor Receptor 3 Recombinant Protein | FGFR3c recombinant protein

Recombinant Human Fibroblast Growth Factor Receptor 3, FGFR3c

Cat. Num. AAA184006

• Gene Names: FGFR3; ACH; CEK2; JTK4; CD333; HSFGFR3EX
• Applications: Western Blot
• Purity: Affinity chromatography. >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon).
• Synonyms: Fibroblast Growth Factor Receptor 3; Recombinant Human Fibroblast Growth Factor Receptor 3; FGFR3c; Fibroblast Growth Factor Receptor 3 (FGFR3); FGFR3 alpha (IIIc); FGFR3c recombinant protein

• Host: HEK293 Cells
• Purity/Purification: Affinity chromatography. >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon).
• Form/Format: Liquid. PBS 20% Glycerol
• Sequence Positions: 23-375aa
• Sequence: ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGGSGHHHHHHHHHH

• Applicable Applications for FGFR3c recombinant protein: Western Blot (WB), Immunoassay (IA), Functional Studies
• Source: Human
• Tag: 10xHis at the C-terminus
• Endotoxin: Less than 0.1ng/ug (1 IEU/ug), as measured by LAL method.
• Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
• Preparation and Storage: Store at -20 degree or -70 degree C for at least 12 months; Shipping: Dry ice or frozen gel packs

SDS-Page

Related Product Information for FGFR3c recombinant protein

It is a single-pass transmembrane protein composed of three extracellular Ig-like domains,a transmembrane region, and a tyrosine kinase domain (1, 2). Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and apoptosis (3, 4, 5, 6). Plays an essentialrole in the regulation of chondrocyte differentiation, proliferation and apoptosis, and isrequired for normal skeleton development. Regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Promotes apoptosis in chondrocytes, but can also promotecancer cell proliferation. Required for normal development of the inner ear. Phosphorylates PLCG1, CBL and FRS2. Ligand binding leads to the activation of several signalling cascades(6). Activation of PLCG1 leads to the production of the cellular signalling moleculesdiacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggersrecruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS,MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signalling pathway, as well as of the AKT1signalling pathway (7, 8, 9). Plays a role in the regulation of vitamin D metabolism.Mutations that lead to constitutive kinase activation or impair normal FGFR3 maturation,internalization and degradation lead to aberrant signalling (10, 11). Over-expressed orconstitutively activated FGFR3 promotes activation of PTPN11/SHP2, STAT1, STAT5A andSTAT5B. Secreted isoform 3 retains its capacity to bind FGF1 and FGF2 and hence mayinterfere with FGF signalling.
FGFR3c is an alternatively spliced isoform representing epithelial variant of FGFR3.

References

1. Jaye et al. (1992) Biochim. Biophys. Acta, 185-199
2. Johnson and Williams. (1993) Adv. Cancer Res., 1-41
3. Terada et al. (2001) Mol. Cell Biol. Res. Commun., 365-373
4. Ornitz et al. (1996) J. Biol. Chem., 15292-15297
5. Agazie et al. (2003) Oncogene, 6909-6918
6. Zhang et al. (2006) J. Biol. Chem., 15694-15700
7. Ben-Zvi et al. (2006) J. Cell Sci., 380-387
8. Harada et al. (2007) Bone, 273-281
9. Citores et al. (2007) J. Cell. Physiol., 148-156
10.Krejci et al. (2008) PLoS ONE, E3961
11.Salazar et al. (2009) Hum. Mol. Genet., 1951-1961

NCBI and Uniprot Product Information

• NCBI GI #: 4503711
• NCBI GeneID: 2261
• NCBI Accession #: NP_000133.1
• NCBI GenBank Nucleotide #: NM_000142.4
• UniProt Accession #: P22607; Q14308; Q16294; Q16608; Q59FL9; D3DVP9; D3DVQ0
• Molecular Weight: 87,710 Da
• NCBI Official Full Name: fibroblast growth factor receptor 3 isoform 1
• NCBI Official Synonym Full Names: fibroblast growth factor receptor 3
• NCBI Official Symbol: FGFR3
• NCBI Official Synonym Symbols: ACH; CEK2; JTK4; CD333; HSFGFR3EX
• NCBI Protein Information: fibroblast growth factor receptor 3; FGFR-3; tyrosine kinase JTK4; hydroxyaryl-protein kinase; fibroblast growth factor receptor 3 variant 4
• UniProt Protein Name: Fibroblast growth factor receptor 3
• Protein Family: Fibroblast growth factor receptor
• UniProt Gene Name: FGFR3
• UniProt Synonym Gene Names: JTK4; FGFR-3
• UniProt Entry Name: FGFR3_HUMAN

NCBI Description

This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia. Three alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Jul 2009]

Uniprot Description

FGFR3: a receptor tyrosine kinase of the highly-conserved FGFR family that binds fibroblast growth factor (FGF). Mutations are associated with thanatophoric dysplasia (TD), craniosynostosis Adelaide type, many craniosynostotic syndromes and bone malformations. Three splice-variant isoforms have been described. Activating point mutations cause dwarfism, including achondroplasia, hypochrondroplasia and thanatophoric dysplasia, and facial and other morphogenetic disorders, including Crouzon syndrome, craniosynostosis Adelaide type, San Diego skeletal displasia and Muenke syndrome. Translocations t(4;14) involving the IgH region are common in multiple myeloma and frequently involve FGFR3. Activated FGFR3 found in 30% of bladder cancers and several cervical cancers, but not in other tumors. Two mutations found in colorectal cancer.

Protein type: Protein kinase, tyrosine (receptor); Protein kinase, TK; Kinase, protein; Membrane protein, integral; EC 2.7.10.1; TK group; FGFR family

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: Golgi apparatus; internal side of plasma membrane; transport vesicle; focal adhesion; cell surface; perinuclear region of cytoplasm; integral to plasma membrane; endoplasmic reticulum; lysosome; extracellular region; plasma membrane; nucleus

Molecular Function: protein binding; fibroblast growth factor binding; fibroblast growth factor receptor activity; protein-tyrosine kinase activity; ATP binding

Biological Process: peptidyl-tyrosine phosphorylation; nerve growth factor receptor signaling pathway; somatic stem cell maintenance; protein amino acid autophosphorylation; negative regulation of transcription from RNA polymerase II promoter; bone mineralization; positive regulation of tyrosine phosphorylation of Stat3 protein; substantia nigra development; inner ear receptor cell differentiation; positive regulation of MAPKKK cascade; cell-cell signaling; positive regulation of neuron apoptosis; forebrain development; positive regulation of cell proliferation; morphogenesis of an epithelium; chondrocyte differentiation; response to axon injury; skeletal development; negative regulation of epithelial cell proliferation; endochondral ossification; epidermal growth factor receptor signaling pathway; negative regulation of developmental growth; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; myelination in the central nervous system; MAPKKK cascade; positive regulation of phosphoinositide 3-kinase activity; digestive tract morphogenesis; JAK-STAT cascade; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of protein ubiquitination; negative regulation of smoothened signaling pathway; negative regulation of mitosis; negative regulation of astrocyte differentiation; insulin receptor signaling pathway; innate immune response; positive regulation of endothelial cell proliferation; lens morphogenesis in camera-type eye; positive regulation of cell differentiation

Disease: Bladder Cancer; Achondroplasia; Hypochondroplasia; Muenke Syndrome; Achondroplasia, Severe, With Developmental Delay And Acanthosis Nigricans; Cervical Cancer; Thanatophoric Dysplasia, Type I; Crouzon Syndrome With Acanthosis Nigricans; Colorectal Cancer; Lacrimoauriculodentodigital Syndrome; Camptodactyly, Tall Stature, And Hearing Loss Syndrome; Thanatophoric Dysplasia, Type Ii; Testicular Germ Cell Tumor; Nevus, Epidermal