Rab GDP dissociation inhibitor beta (GDI2) Recombinant Protein | GDI2 recombinant protein
Recombinant Dog Rab GDP dissociation inhibitor beta (GDI2)
Gene Names
GDI2; GDI-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rab GDP dissociation inhibitor beta (GDI2); Recombinant Dog Rab GDP dissociation inhibitor beta (GDI2); GDI2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-445, Full length protein
Sequence
MNEEYDVIVLGTGLTECILSGIMTVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGAPPASMGRGRDWNLDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTAIGEVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEVARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTAETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Sequence Length
445
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GDI2 recombinant protein
GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion
deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,322 Da
NCBI Official Full Name
rab GDP dissociation inhibitor beta
NCBI Official Synonym Full Names
GDP dissociation inhibitor 2
NCBI Official Symbol
GDI2
NCBI Official Synonym Symbols
GDI-2
NCBI Protein Information
rab GDP dissociation inhibitor beta
UniProt Protein Name
Rab GDP dissociation inhibitor beta
Protein Family
UniProt Gene Name
GDI2
UniProt Synonym Gene Names
Rab GDI beta; GDI-2
Uniprot Description
Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
Similar Products
Product Notes
The GDI2 gdi2 (Catalog #AAA1134472) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-445, Full length protein. The amino acid sequence is listed below: MNEEYDVIVL GTGLTECILS GIMTVNGKKV LHMDRNPYYG GESASITPLE DLYKRFKIPG APPASMGRGR DWNLDLIPKF LMANGQLVKM LLYTEVTRYL DFKVTEGSFV YKGGKIYKVP STEAEALASS LMGLFEKRRF RKFLVYVANF DEKDPRTFEG IDPKKTAIGE VYKKFDLGQD VIDFTGHALA LYRTDDYLDQ PCCETINRIK LYSESLARYG KSPYLYPLYG LGELPQGFAR LSAIYGGTYM LNKPIEEIIV QNGKVIGVKS EGEVARCKQL ICDPSYVKDR VEKVGQVIRV ICILSHPIKN TNDANSCQII IPQNQVNRKS DIYVCMISSA HNVAAQGKYI AIVSTTAETK EPEKEIRPAL ELLEPIEQKF VSISDLLVPK DLGTESQIFI SRTYDATTHF ETTCDDIKNI YKRMTGSEFD FEEMKRKKND IYGED. It is sometimes possible for the material contained within the vial of "Rab GDP dissociation inhibitor beta (GDI2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
