Growth/differentiation factor 9 Recombinant Protein | GDF9 recombinant protein

Recombinant Human Growth/differentiation factor 9

Cat. Num. AAA1071262

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Growth/differentiation factor 9; Recombinant Human Growth/differentiation factor 9; GDF9 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 320-454aa; Full Length
• Sequence: GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR
• Sequence Length: 366

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for GDF9 recombinant protein

Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells.

Product Categories/Family for GDF9 recombinant protein

Cardiovascular

References

The DNA sequence and comparative analysis of human chromosome 5.Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S., Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.Nature 431:268-274(2004) Human growth differentiation factor 9 (GDF-9) and its novel homolog GDF-9B are expressed in oocytes during early folliculogenesis.Aaltonen J., Laitinen M.P., Vuojolainen K., Jaatinen R., Horelli-Kuitunen N., Seppae L., Louhio H., Tuuri T., Sjoeberg J., Buetzow R., Hovatta O., Dale L., Ritvos O.J. Clin. Endocrinol. Metab. 84:2744-2750(1999) Growth differentiation factor-9 inhibits 3'5'-adenosine monophosphate-stimulated steroidogenesis in human granulosa and theca cells.Yamamoto N., Christenson L.K., McAllister J.M., Strauss J.F. IIIJ. Clin. Endocrinol. Metab. 87:2849-2856(2002) ErratumYamamoto N., Christenson L.K., McAllister J.M., Strauss J.F. IIIJ. Clin. Endocrinol. Metab. 87:4495-4495(2002) Phosphorylation of bone morphogenetic protein-15 and growth and differentiation factor-9 plays a critical role in determining agonistic or antagonistic functions.McMahon H.E., Sharma S., Shimasaki S.Endocrinology 149:812-817(2008) Effects of growth differentiation factor 9 on cell cycle regulators and ERK42/44 in human granulosa cell proliferation.Huang Q., Cheung A.P., Zhang Y., Huang H.F., Auersperg N., Leung P.C.Am. J. Physiol. 296:E1344-E1353(2009) Golgi apparatus casein kinase phosphorylates bioactive Ser-6 of bone morphogenetic protein 15 and growth and differentiation factor 9.Tibaldi E., Arrigoni G., Martinez H.M., Inagaki K., Shimasaki S., Pinna L.A.FEBS Lett. 584:801-805(2010) Growth differentiation factor 9 reverses activin A suppression of steroidogenic acute regulatory protein expression and progesterone production in human granulosa-lutein cells.Shi F.T., Cheung A.P., Klausen C., Huang H.F., Leung P.C.J. Clin. Endocrinol. Metab. 95:E172-E180(2010) Growth differentiating factor 9 (GDF9) and bone morphogenetic protein 15 both activate development of human primordial follicles in vitro, with seemingly more beneficial effects of GDF9.Kedem A., Fisch B., Garor R., Ben-Zaken A., Gizunterman T., Felz C., Ben-Haroush A., Kravarusic D., Abir R.J. Clin. Endocrinol. Metab. 96:E1246-E1254(2011) Growth differentiation factor 9 (GDF9) suppresses follistatin and follistatin-like 3 production in human granulosa-lutein cells.Shi F.T., Cheung A.P., Huang H.F., Leung P.C.PLoS ONE 6:E22866-E22866(2011) The ratio of growth differentiation factor 9 bone morphogenetic protein 15 mRNA expression is tightly co-regulated and differs between species over a wide range of ovulation rates.Crawford J.L., McNatty K.P.Mol. Cell. Endocrinol. 348:339-343(2012) Mutational screening of the coding region of growth differentiation factor 9 gene in Indian women with ovarian failure.Dixit H., Rao L.K., Padmalatha V., Kanakavalli M., Deenadayal M., Gupta N., Chakravarty B., Singh L.Menopause 12:749-754(2005) Mutations and sequence variants in GDF9 and BMP15 in patients with premature ovarian failure.Laissue P., Christin-Maitre S., Touraine P., Kuttenn F., Ritvos O., Aittomaki K., Bourcigaux N., Jacquesson L., Bouchard P., Frydman R., Dewailly D., Reyss A.-C., Jeffery L., Bachelot A., Massin N., Fellous M., Veitia R.A.Eur. J. Endocrinol. 154:739-744(2006) Novel variants in growth differentiation factor 9 in mothers of dizygotic twins.Palmer J.S., Zhao Z.Z., Hoekstra C., Hayward N.K., Webb P.M., Whiteman D.C., Martin N.G., Boomsma D.I., Duffy D.L., Montgomery G.W.J. Clin. Endocrinol. Metab. 91:4713-4716(2006) Growth differentiating factor-9 mutations may be associated with premature ovarian failure.Kovanci E., Rohozinski J., Simpson J.L., Heard M.J., Bishop C.E., Carson S.A.Fertil. Steril. 87:143-146(2007) Analyses of GDF9 mutation in 100 Chinese women with premature ovarian failure.Zhao H., Qin Y., Kovanci E., Simpson J.L., Chen Z.J., Rajkovic A.Fertil. Steril. 88:1474-1476(2007) Analyses of growth differentiation factor 9 (GDF9) and bone morphogenetic protein 15 (BMP15) mutation in Chinese women with premature ovarian failure.Wang B., Wen Q., Ni F., Zhou S., Wang J., Cao Y., Ma X.Clin. Endocrinol. (Oxf.) 72:135-136(2010)

NCBI and Uniprot Product Information

• NCBI GI #: 572152931
• NCBI GeneID: 2661
• NCBI Accession #: NP_001275753.1
• NCBI GenBank Nucleotide #: NM_001288824.2
• UniProt Accession #: O60383; Q4VAW5
• Molecular Weight: 42.5 kDa
• NCBI Official Full Name: growth/differentiation factor 9 isoform 2
• NCBI Official Synonym Full Names: growth differentiation factor 9
• NCBI Official Symbol: GDF9
• NCBI Protein Information: growth/differentiation factor 9
• UniProt Protein Name: Growth/differentiation factor 9
• Protein Family: Growth/differentiation factor
• UniProt Gene Name: GDF9
• UniProt Synonym Gene Names: GDF-9
• UniProt Entry Name: GDF9_HUMAN

NCBI Description

This gene encodes a member of the transforming growth factor-beta superfamily. The encoded preproprotein is processed into a secreted factor that is required for ovarian folliculogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

GDF9: Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells. Altered GDF9 function may be involved in ovarian disorders. Rare variants in GDF9 have been found in patients with premature ovarian failure and mothers of dizygotic twins. Belongs to the TGF-beta family.

Protein type: Cytokine; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: cytoplasm; extracellular space

Molecular Function: cytokine activity; growth factor activity; transforming growth factor beta receptor binding

Biological Process: BMP signaling pathway; cell development; female gamete generation; negative regulation of cell growth; oocyte growth; positive regulation of cell proliferation; regulation of apoptosis; regulation of MAPKKK cascade; transforming growth factor beta receptor signaling pathway