Growth/differentiation factor 6 (Gdf6) Recombinant Protein | Gdf6 recombinant protein

Recombinant Mouse Growth/differentiation factor 6 (Gdf6)

Cat. Num. AAA954109

• Gene Names: Gdf6; BMP13; GDF16; BMP-13
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Growth/differentiation factor 6 (Gdf6); Recombinant Mouse Growth/differentiation factor 6 (Gdf6); Gdf6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 335-454, Full length protein
• Sequence: TAFASRHGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
• Sequence Length: 120

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Gdf6 recombinant protein

This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily of secreted signaling molecules. It is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mutations in this gene result in colobomata, which are congenital abnormalities in ocular development, and in Klippel-Feil syndrome (KFS), which is a congenital disorder of spinal segmentation.

NCBI and Uniprot Product Information

• NCBI GI #: 41529818
• NCBI GeneID: 242316
• NCBI Accession #: NP_038554.1
• NCBI GenBank Nucleotide #: NM_013526.1
• UniProt Accession #: P43028; Q70UT4
• Molecular Weight: 50,942 Da
• NCBI Official Full Name: growth/differentiation factor 6 preproprotein
• NCBI Official Synonym Full Names: growth differentiation factor 6
• NCBI Official Symbol: Gdf6
• NCBI Official Synonym Symbols: BMP13; GDF16; BMP-13
• NCBI Protein Information: growth/differentiation factor 6
• UniProt Protein Name: Growth/differentiation factor 6
• Protein Family: Growth/differentiation factor
• UniProt Gene Name: Gdf6
• UniProt Synonym Gene Names: Bmp13; Gdf-6; Gdf16; GDF-6; BMP-13

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mice lacking a functional copy of this gene exhibit joint and skeletal defects. [provided by RefSeq, Sep 2016]

Uniprot Description

Growth factor that controls proliferation and cellular differentiation in the retina and bone formation. Plays a key role in regulating apoptosis during retinal development. Establishes dorsal-ventral positional information in the retina and controls the formation of the retinotectal map (PubMed:23307924). Required for normal formation of bones and joints in the limbs, skull, digits and axial skeleton. Plays a key role in establishing boundaries between skeletal elements during development. Regulation of GDF6 expression seems to be a mechanism for evolving species-specific changes in skeletal strucutres (PubMed:26774823). Seems to positively regulates differentiation of chondrogenic tissue through the growth factor receptors subunits BMPR1A, BMPR1B, BMPR2 and ACVR2A, leading to the activation of SMAD1-SMAD5-SMAD8 complex. The regulation of chondrogenic differentiation is inhibited by NOG (PubMed:12606286, PubMed:16049014). Also involved in the induction of adipogenesis from mesenchymal stem cells. This mechanism acts through the growth factor receptors subunits BMPR1A, BMPR2 and ACVR2A and the activation of SMAD1-SMAD5-SMAD8 complex and MAPK14/p38 (PubMed:23527555).