Growth/Differentiation Factor 15 (GDF15) Recombinant Protein | GDF15 recombinant protein

Recombinant Human Growth/Differentiation Factor 15 (GDF15), Partial

Cat. Num. AAA7115336

• Gene Names: GDF15; PDF; MIC1; PLAB; MIC-1; NAG-1; PTGFB; GDF-15
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Growth/Differentiation Factor 15 (GDF15); Recombinant Human Growth/Differentiation Factor 15 (GDF15); Partial; Macrophage inhibitory cytokine 1; MIC-1; NSAID-activated gene 1 protein; NAG-1; NSAID-regulated gene 1 protein; NRG-1; Placental TGF-beta; Placental bone morphogenetic protein; Prostate differentiation factor; GDF-15; GDF15 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 197-308aa; Partial
• Sequence: ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
• Sequence Length: 308

• Species: Human
• Tag: N-terminal 6xHis-tagged
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for GDF15 recombinant protein

Regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor, GFRAL, and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which contitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions. On hepatocytes, inhibits growth hormone signaling.

Product Categories/Family for GDF15 recombinant protein

Cardiovascular

References

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45(2004).

NCBI and Uniprot Product Information

• NCBI GI #: 153792495
• NCBI GeneID: 9518
• NCBI Accession #: NP_004855.2
• NCBI GenBank Nucleotide #: NM_004864.4
• UniProt Accession #: Q99988
• Molecular Weight: 16.4 kDa
• NCBI Official Full Name: growth/differentiation factor 15 preproprotein
• NCBI Official Synonym Full Names: growth differentiation factor 15
• NCBI Official Symbol: GDF15
• NCBI Official Synonym Symbols: PDF; MIC1; PLAB; MIC-1; NAG-1; PTGFB; GDF-15
• NCBI Protein Information: growth/differentiation factor 15
• UniProt Protein Name: Growth/differentiation factor 15
• Protein Family: Growth/differentiation factor
• UniProt Gene Name: GDF15
• UniProt Synonym Gene Names: MIC1; PDF; PLAB; PTGFB; GDF-15; MIC-1; NAG-1; NRG-1
• UniProt Entry Name: GDF15_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress. [provided by RefSeq, Aug 2016]

Uniprot Description

GDF15: disulfide-linked. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: extracellular space; extracellular region

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: regulation of apoptosis; cell-cell signaling; transforming growth factor beta receptor signaling pathway; regulation of MAPKKK cascade; signal transduction; cell development