Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Envelope glycoprotein D (gD) Recombinant Protein | gD recombinant protein

Recombinant Equine herpesvirus 1 Envelope glycoprotein D (gD)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope glycoprotein D (gD); Recombinant Equine herpesvirus 1 Envelope glycoprotein D (gD); Recombinant Envelope glycoprotein D (gD); Envelope glycoprotein D; gD; Glycoprotein 17/18; gD recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-452
Sequence
TQKLSLGLYNQWWRVCRSVPPPWYVFFNKRSMSTFKLMMDGRLVFAMAIAILSVVLSCGTCEKAKRAVRGRQDRPKEFPPPRYNYTILTRYNATALASPFINDQVKNVDLRIVTATRPCEMIALIAKTNIDSILKELAAAQKTYSARLTWFKIMPTCATPIHDVSYMKCNPKLSFAMCDERSDILWQASLITMAAETDDELGLVLAAPAHSASGLYRRVIEIDGRRIYTDFSVTIPSERCPIAFEQNFGNPDRCKTPEQYSRGEVFTRRFLGEFNFPQGEHMTWLKFWFVYDGGNLPVQFYEAQAFARPVPPDNHPGFDSVESEITQNKTDPKPGQADPKPNQPFKWPSIKHLAPRLDEVDEVIEPVTKPPKTSKSNSTFVGISVGLGIAGLVLVGVILYVCLRRKKELKKSAQNGLTRLRSTFKDVKYTQLP
Sequence Length
452
Species
Equine herpesvirus 1 (strain Kentucky D) (EHV-1) (Equine abortion virus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
51,099 Da
NCBI Official Full Name
Envelope glycoprotein D
UniProt Protein Name
Envelope glycoprotein D
Protein Family
UniProt Gene Name
gD
UniProt Synonym Gene Names
GP17/18; gD
UniProt Entry Name
GD_EHV1D

Uniprot Description

Function: Envelope glycoprotein that binds to host cell entry receptors. May trigger fusion with host membrane, by recruiting the fusion machinery composed of gB and gH/gL

By similarity.

Subcellular location: Virion membrane; Single-pass type I membrane protein

By similarity. Note: During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs

By similarity.

Sequence similarities: Belongs to the herpesviridae glycoprotein D family.

Caution: It is uncertain whether Met-1 or Met-51 is the initiator.

Similar Products

Product Notes

The Envelope glycoprotein D (gD) gd (Catalog #AAA1179769) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-452. The amino acid sequence is listed below: TQKLSLGLYN QWWRVCRSVP PPWYVFFNKR SMSTFKLMMD GRLVFAMAIA ILSVVLSCGT CEKAKRAVRG RQDRPKEFPP PRYNYTILTR YNATALASPF INDQVKNVDL RIVTATRPCE MIALIAKTNI DSILKELAAA QKTYSARLTW FKIMPTCATP IHDVSYMKCN PKLSFAMCDE RSDILWQASL ITMAAETDDE LGLVLAAPAH SASGLYRRVI EIDGRRIYTD FSVTIPSERC PIAFEQNFGN PDRCKTPEQY SRGEVFTRRF LGEFNFPQGE HMTWLKFWFV YDGGNLPVQF YEAQAFARPV PPDNHPGFDS VESEITQNKT DPKPGQADPK PNQPFKWPSI KHLAPRLDEV DEVIEPVTKP PKTSKSNSTF VGISVGLGIA GLVLVGVILY VCLRRKKELK KSAQNGLTRL RSTFKDVKYT QLP. It is sometimes possible for the material contained within the vial of "Envelope glycoprotein D (gD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.