Translational activator GCN1 (GCN1L1) Recombinant Protein | GCN1L1 recombinant protein
Recombinant Human Translational activator GCN1 (GCN1L1) , partial
Gene Names
GCN1; GCN1L; GCN1L1; PRIC295
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Translational activator GCN1 (GCN1L1); Recombinant Human Translational activator GCN1 (GCN1L1); partial; GCN1L1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2052-2428, Partial.
Sequence
LDDEEVSEFALDGLKQVMAIKSRVVLPYLVPKLTTPPVNTRVLAFLSSVAGDALTRHLGVILPAVMLALKEKLGTPDEQLEMANCQAVILSVEDDTGHRIIIEYLLEATRSPEVGMRQAAAIILNIYCSRSKADYTSHLRSLVSGLIRLFNDSSPVVLEESWDALNAITKKLDAGNQLALIEELHKEIRLIGNESKGEHVPGFCLPKKGVTSILPVLREGVLTGSPEQKEEAAKALGLVIRLTSADALRPSVVSITGPLIRILGDRFSWNVKAALLETLSLLLAKVGIALKPFLPQLQT TFTKALQDSNRGVRLKAADALGKLISIHIKVDPLFTELLNGIRAMEDPGV RDTMLQALRFVIQGAGAKVDAVIRKNIV
Sequence Length
2428
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
292,758 Da
NCBI Official Full Name
eIF-2-alpha kinase activator GCN1
NCBI Official Synonym Full Names
GCN1, eIF2 alpha kinase activator homolog
NCBI Official Symbol
GCN1
NCBI Official Synonym Symbols
GCN1L; GCN1L1; PRIC295
NCBI Protein Information
eIF-2-alpha kinase activator GCN1
UniProt Protein Name
eIF-2-alpha kinase activator GCN1
UniProt Gene Name
GCN1
UniProt Synonym Gene Names
HsGCN1
Uniprot Description
Acts as a positive activator of the EIF2AK4/GCN2 protein kinase activity in response to amino acid starvation. Forms a complex with EIF2AK4/GCN2 on translating ribosomes; during this process, GCN1 seems to act as a chaperone to facilitate delivery of uncharged tRNAs that enter the A site of ribosomes to the tRNA-binding domain of EIF2AK4/GCN2, and hence stimulating EIF2AK4/GCN2 kinase activity. Participates in the repression of global protein synthesis and in gene-specific mRNA translation activation, such as the transcriptional activator ATF4, by promoting the EIF2AK4/GCN2-mediated phosphorylation of eukaryotic translation initiation factor 2 (eIF-2-alpha/EIF2S1) on 'Ser-52', and hence allowing ATF4-mediated reprogramming of amino acid biosynthetic gene expression to alleviate nutrient depletion.
Research Articles on GCN1L1
Similar Products
Product Notes
The GCN1L1 gcn1 (Catalog #AAA1422959) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2052-2428, Partial. The amino acid sequence is listed below: LDDEEVSEFA LDGLKQVMAI KSRVVLPYLV PKLTTPPVNT RVLAFLSSVA GDALTRHLGV ILPAVMLALK EKLGTPDEQL EMANCQAVIL SVEDDTGHRI IIEYLLEATR SPEVGMRQAA AIILNIYCSR SKADYTSHLR SLVSGLIRLF NDSSPVVLEE SWDALNAITK KLDAGNQLAL IEELHKEIRL IGNESKGEHV PGFCLPKKGV TSILPVLREG VLTGSPEQKE EAAKALGLVI RLTSADALRP SVVSITGPLI RILGDRFSWN VKAALLETLS LLLAKVGIAL KPFLPQLQT TFTKALQDSN RGVRLKAADA LGKLISIHIK VDPLFTELLN GIRAMEDPGV RDTMLQALRF VIQGAGAKVD AVIRKNIV. It is sometimes possible for the material contained within the vial of "Translational activator GCN1 (GCN1L1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
