Chorion-specific transcription factor GCMa (Gcm1) Recombinant Protein | Gcm1 recombinant protein
Recombinant Mouse Chorion-specific transcription factor GCMa (Gcm1)
Gene Names
Gcm1; GCMa; glide; Gcm-rs2; Gcm1-rs1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chorion-specific transcription factor GCMa (Gcm1); Recombinant Mouse Chorion-specific transcription factor GCMa (Gcm1); Gcm1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-436, Full length protein
Sequence
MELDDFDPEDKEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMKKVHMASASNSLRMKGRPAAKALPAEIPSQGSLPLTWSFQEGVQLPGTYSTPLIANAPQQNSLNDCLSFPKSYDLGGSTELEDPTSTLDSMKFYERCKFSSSRIYGSEEQFQPPVPGTYGDYEDLQTWNKNVALGRNPSDDIYYPAYPLPVASWPYDYFPSQNSLEHLPQQVPSEPPAAQPGCHPLWSNPGGEPYEEKVSVDLSSYVPSLTYHPPQQDPFLLTYGSPTQQQHALPGKSNRWDFDEEMACMGLDHFNNEMLLNFCSLR
Sequence Length
436
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gcm1 recombinant protein
This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A
G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.
G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,589 Da
NCBI Official Full Name
chorion-specific transcription factor GCMa
NCBI Official Synonym Full Names
glial cells missing homolog 1
NCBI Official Symbol
Gcm1
NCBI Official Synonym Symbols
GCMa; glide; Gcm-rs2; Gcm1-rs1
NCBI Protein Information
chorion-specific transcription factor GCMa
UniProt Protein Name
Chorion-specific transcription factor GCMa
Protein Family
UniProt Gene Name
Gcm1
UniProt Synonym Gene Names
Gcma; mGCM1; mGCMa
Uniprot Description
Transcription factor that is necessary for placental development (PubMed:8962155). Involved in the control of expression of placental growth factor (PGF) and other placenta-specific genes. Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer. Binds to the SYDE1 promoter. Has a central role in mediating the differentiation of trophoblast cells along both the villous and extravillous pathways in placental development ().
Research Articles on Gcm1
Similar Products
Product Notes
The Gcm1 gcm1 (Catalog #AAA958796) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-436, Full length protein. The amino acid sequence is listed below: MELDDFDPED KEILSWDIND VKLPQNVKTT DWFQEWPDSY VKHIYSSDDR NAQRHLSSWA MRNTNNHNSR ILKKSCLGVV VCSRDCSTEE GRKIYLRPAI CDKARQKQQR KSCPNCNGPL KLIPCRGHGG FPVTNFWRHD GRFIFFQSKG EHDHPRPETK LEAEARRAMK KVHMASASNS LRMKGRPAAK ALPAEIPSQG SLPLTWSFQE GVQLPGTYST PLIANAPQQN SLNDCLSFPK SYDLGGSTEL EDPTSTLDSM KFYERCKFSS SRIYGSEEQF QPPVPGTYGD YEDLQTWNKN VALGRNPSDD IYYPAYPLPV ASWPYDYFPS QNSLEHLPQQ VPSEPPAAQP GCHPLWSNPG GEPYEEKVSV DLSSYVPSLT YHPPQQDPFL LTYGSPTQQQ HALPGKSNRW DFDEEMACMG LDHFNNEMLL NFCSLR. It is sometimes possible for the material contained within the vial of "Chorion-specific transcription factor GCMa (Gcm1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
