Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chorion-specific transcription factor GCMa (GCM1) Recombinant Protein | GCM1 recombinant protein

Recombinant Human Chorion-specific transcription factor GCMa (GCM1)

Gene Names
GCM1; GCMA; hGCMa
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chorion-specific transcription factor GCMa (GCM1); Recombinant Human Chorion-specific transcription factor GCMa (GCM1); GCM1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-436, Full length protein
Sequence
MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEARRAMKKVNTAPSSVSLSLKGSTETRSLPGETQSQGSLPLTWSFQEGVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDLTDQTSTVDPMKLYEKRKLSSSRTYSSGDLLPPSASGVYSDHGDLQAWSKNAALGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCPLR
Sequence Length
436
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GCM1 recombinant protein
This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A
G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,268 Da
NCBI Official Full Name
chorion-specific transcription factor GCMa
NCBI Official Synonym Full Names
glial cells missing homolog 1
NCBI Official Symbol
GCM1
NCBI Official Synonym Symbols
GCMA; hGCMa
NCBI Protein Information
chorion-specific transcription factor GCMa
UniProt Protein Name
Chorion-specific transcription factor GCMa
UniProt Gene Name
GCM1
UniProt Synonym Gene Names
GCMA; hGCMa

NCBI Description

This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. [provided by RefSeq, Jul 2008]

Uniprot Description

Transcription factor involved in the control of expression of placental growth factor (PGF) and other placenta-specific genes (PubMed:10542267, PubMed:18160678). Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer (PubMed:10542267). Binds to the SYDE1 promoter (PubMed:27917469). Has a central role in mediating the differentiation of trophoblast cells along both the villous and extravillous pathways in placental development (PubMed:19219068).

Research Articles on GCM1

Similar Products

Product Notes

The GCM1 gcm1 (Catalog #AAA1410914) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-436, Full length protein. The amino acid sequence is listed below: MEPDDFDSED KEILSWDIND VKLPQNVKKT DWFQEWPDSY AKHIYSSEDK NAQRHLSSWA MRNTNNHNSR ILKKSCLGVV VCGRDCLAEE GRKIYLRPAI CDKARQKQQR KRCPNCDGPL KLIPCRGHGG FPVTNFWRHD GRFIFFQSKG EHDHPKPETK LEAEARRAMK KVNTAPSSVS LSLKGSTETR SLPGETQSQG SLPLTWSFQE GVQLPGSYSG HLIANTPQQN SLNDCFSFSK SYGLGGITDL TDQTSTVDPM KLYEKRKLSS SRTYSSGDLL PPSASGVYSD HGDLQAWSKN AALGRNHLAD NCYSNYPFPL TSWPCSFSPS QNSSEPFYQQ LPLEPPAAKT GCPPLWPNPA GNLYEEKVHV DFNSYVQSPA YHSPQEDPFL FTYASHPHQQ YSLPSKSSKW DFEEEMTYLG LDHCNNDMLL NLCPLR. It is sometimes possible for the material contained within the vial of "Chorion-specific transcription factor GCMa (GCM1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.