Gibberellin-regulated protein 4 (GASA4) Recombinant Protein | GASA4 recombinant protein
Recombinant Arabidopsis thaliana Gibberellin-regulated protein 4 (GASA4)
Gene Names
GASA4; F8M21.120; F8M21_120; GAST1 protein homolog 4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gibberellin-regulated protein 4 (GASA4); Recombinant Arabidopsis thaliana Gibberellin-regulated protein 4 (GASA4); GASA4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-106, Full length protein
Sequence
SSGSNVKWSQKRYGPGSLKRTQCPSECDRRCKKTQYHKACITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP
Sequence Length
81
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
11,996 Da
NCBI Official Full Name
GAST1 protein homolog 4
NCBI Official Symbol
GASA4
NCBI Official Synonym Symbols
F8M21.120; F8M21_120; GAST1 protein homolog 4
NCBI Protein Information
GAST1 protein homolog 4
UniProt Protein Name
Gibberellin-regulated protein 4
Protein Family
UniProt Gene Name
GASA4
NCBI Description
Encodes gibberellin-regulated protein GASA4. Promotes GA responses and exhibits redox activity.
Uniprot Description
Gibberellin-regulated protein involved in the regulation of floral meristem and floral organ identity, and promotion of seed size and weight. May play a role in the promotion of gibberellin responses such as regulation of flowering under short-day conditions, seed germination and inhibition of gibberellin oxidase. Possesses redox activity in E.coli and may function in redox regulation in planta.
Research Articles on GASA4
Similar Products
Product Notes
The GASA4 gasa4 (Catalog #AAA1168204) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-106, Full length protein. The amino acid sequence is listed below: SSGSNVKWSQ KRYGPGSLKR TQCPSECDRR CKKTQYHKAC ITFCNKCCRK CLCVPPGYYG NKQVCSCYNN WKTQEGGPKC P. It is sometimes possible for the material contained within the vial of "Gibberellin-regulated protein 4 (GASA4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
