Galactocerebrosidase (Galc) Recombinant Protein | Galc recombinant protein

Recombinant Mouse Galactocerebrosidase (Galc)

Cat. Num. AAA7053527

• Gene Names: Galc; twi; Gacy; AW212969; AW413532; twitcher; 2310068B06Rik; A930008M05Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Galactocerebrosidase (Galc); Recombinant Mouse Galactocerebrosidase (Galc); Galactocerebroside beta-galactosidase; Galactosylceramidase; Galactosylceramide beta-galactosidase; Galc recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 43-684. Full Length of Mature Protein
• Sequence: YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGTPQQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR

• Species: Mus musculus (Mouse)
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.

SDS-PAGE

Related Product Information for Galc recombinant protein

Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon.

Product Categories/Family for Galc recombinant protein

Cardiovascular; Transmembrane Protein

References

"Molecular cloning and expression of cDNA for murine galactocerebrosidase and mutation analysis of the twitcher mouse, a model of Krabbe's disease."Sakai N., Inui K., Tatsumi N., Fukushima H., Nishigaki T., Taniike M., Nishimoto J., Tsukamoto H., Yanagihara I., Ozono K., Okada S.J. Neurochem. 66:1118-1124(1996)

NCBI and Uniprot Product Information

• NCBI GI #: 93102411
• NCBI GeneID: 14420
• NCBI Accession #: NP_032105.2
• NCBI GenBank Nucleotide #: NM_008079.4
• UniProt Accession #: P54818; O35151; Q3U3H7
• Molecular Weight: 73.1 kDa
• NCBI Official Full Name: galactocerebrosidase
• NCBI Official Synonym Full Names: galactosylceramidase
• NCBI Official Symbol: Galc
• NCBI Official Synonym Symbols: twi; Gacy; AW212969; AW413532; twitcher; 2310068B06Rik; A930008M05Rik
• NCBI Protein Information: galactocerebrosidase
• UniProt Protein Name: Galactocerebrosidase
• Protein Family: Galactocerebrosidase
• UniProt Gene Name: Galc
• UniProt Synonym Gene Names: GALCERase

NCBI Description

This gene encodes galactosylceramidase, the lysosomal hydryolase involved in the catabolism of galactosylceramide. Mutations in this gene result in slow growth, tremors and hind leg weakness, collectively termed as the 'twitcher' phenotype. In humans, deficiency of this gene product causes a lysosomal storage disorder known as Krabbe disease. [provided by RefSeq, Dec 2014]

Uniprot Description

Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon.