Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

G antigen 5 Recombinant Protein | GAGE5 recombinant protein

Recombinant Human G antigen 5

Gene Names
GAGE4; CT4.4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G antigen 5; Recombinant Human G antigen 5; Cancer/testis antigen 4.5; CT4.5; GAGE5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-117aa; Full Length
Sequence
MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
Sequence Length
117
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Product Categories/Family for GAGE5 recombinant protein
References
A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.van den Eynde B., Peeters O., de Backer O., Gaugler B., Lucas S., Boon T.J. Exp. Med. 182:689-698(1995)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.9 kDa
NCBI Official Full Name
G antigen 4
NCBI Official Synonym Full Names
G antigen 4
NCBI Official Symbol
GAGE4
NCBI Official Synonym Symbols
CT4.4
NCBI Protein Information
G antigen 4
UniProt Protein Name
G antigen 5
Protein Family
UniProt Gene Name
GAGE5
UniProt Synonym Gene Names
GAGE-5; CT4.5
UniProt Entry Name
GAGE5_HUMAN

NCBI Description

This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YYWPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. [provided by RefSeq, Jul 2008]

Uniprot Description

GAGE5: a member of a family of the GAGE family of proteins that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YYWPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xp11.4-p11.2

Molecular Function: protein binding

Similar Products

Product Notes

The GAGE5 gage5 (Catalog #AAA1265542) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-117aa; Full Length. The amino acid sequence is listed below: MSWRGRSTYY WPRPRRYVQP PEVIGPMRPE QFSDEVEPAT PEEGEPATQR QDPAAAQEGE DEGASAGQGP KPEADSQEQG HPQTGCECED GPDGQEMDPP NPEEVKTPEE GEKQSQC. It is sometimes possible for the material contained within the vial of "G antigen 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.