Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2) Recombinant Protein | GABRB2 recombinant protein

Recombinant Human Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2), partial

Gene Names
GABRB2; ICEE2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2); Recombinant Human Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2); partial; GABRB2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-244. Partial
Sequence
SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,741 Da
NCBI Official Full Name
gamma-aminobutyric acid receptor subunit beta-2 isoform 2
NCBI Official Synonym Full Names
gamma-aminobutyric acid type A receptor beta2 subunit
NCBI Official Symbol
GABRB2
NCBI Official Synonym Symbols
ICEE2
NCBI Protein Information
gamma-aminobutyric acid receptor subunit beta-2
UniProt Protein Name
Gamma-aminobutyric acid receptor subunit beta-2
UniProt Gene Name
GABRB2

NCBI Description

The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. Alternative splicing of this gene generates 2 transcript variants, differing by a 114 bp insertion. [provided by RefSeq, Jul 2008]

Uniprot Description

Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand-gated chloride channel.

Research Articles on GABRB2

Similar Products

Product Notes

The GABRB2 gabrb2 (Catalog #AAA953526) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-244. Partial. The amino acid sequence is listed below: SVNDPSNMSL VKETVDRLLK GYDIRLRPDF GGPPVAVGMN IDIASIDMVS EVNMDYTLTM YFQQAWRDKR LSYNVIPLNL TLDNRVADQL WVPDTYFLND KKSFVHGVTV KNRMIRLHPD GTVLYGLRIT TTAACMMDLR RYPLDEQNCT LEIESYGYTT DDIEFYWRGD DNAVTGVTKI ELPQFSIVDY KLITKKVVFS TGSYPRLSLS FKLKRNIGY . It is sometimes possible for the material contained within the vial of "Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.