RNA-binding protein FUS (FUS) Recombinant Protein | FUS recombinant protein

Recombinant Human RNA-binding protein FUS (FUS)

• Gene Names: FUS; TLS; ALS6; ETM4; FUS1; POMP75; HNRNPP2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: RNA-binding protein FUS (FUS); Recombinant Human RNA-binding protein FUS (FUS); FUS recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-526. Full Length Protein
• Sequence: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for FUS recombinant protein

This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA
microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

NCBI and Uniprot Product Information

• NCBI GI #: 283135201
• NCBI GeneID: 2521
• NCBI Accession #: NP_001164105.1
• NCBI GenBank Nucleotide #: NM_001170634.1
• UniProt Accession #: P35637; Q9H4A8
• Molecular Weight: 53,355 Da
• NCBI Official Full Name: RNA-binding protein FUS isoform 2
• NCBI Official Synonym Full Names: FUS RNA binding protein
• NCBI Official Symbol: FUS
• NCBI Official Synonym Symbols: TLS; ALS6; ETM4; FUS1; POMP75; HNRNPP2
• NCBI Protein Information: RNA-binding protein FUS
• UniProt Protein Name: RNA-binding protein FUS
• Protein Family: RNA-binding protein
• UniProt Gene Name: FUS
• UniProt Synonym Gene Names: TLS

NCBI Description

This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. [provided by RefSeq, Sep 2009]

Uniprot Description

Binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. May play a role in maintenance of genomic integrity.