SDS-Page
Tissue alpha-L-fucosidase (Fuca1) Recombinant Protein | Fuca1 recombinant protein
Recombinant Mouse Tissue alpha-L-fucosidase (Fuca1)
Gene Names
Fuca1; Afuc; Fuca; 0610006A03Rik; 9530055J05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tissue alpha-L-fucosidase (Fuca1); Recombinant Mouse Tissue alpha-L-fucosidase (Fuca1); Tissue alpha-L-fucosidase; EC=3.2.1.51; Alpha-L-fucosidase I; Alpha-L-fucoside fucohydrolase 1; Alpha-L-fucosidase 1; Fuca1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-452. Full Length of Mature Protein
Sequence
LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN
Species
Mus musculus (Mouse)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for Fuca1 recombinant protein
Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
Product Categories/Family for Fuca1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66.6 kDa
NCBI Official Full Name
tissue alpha-L-fucosidase
NCBI Official Synonym Full Names
fucosidase, alpha-L- 1, tissue
NCBI Official Symbol
Fuca1
NCBI Official Synonym Symbols
Afuc; Fuca; 0610006A03Rik; 9530055J05Rik
NCBI Protein Information
tissue alpha-L-fucosidase; alpha-L-fucosidase 1; alpha-L-fucosidase I; fucosidase, alpha-L-1, tissue; alpha-L-fucoside fucohydrolase 1
UniProt Protein Name
Tissue alpha-L-fucosidase
Protein Family
UniProt Gene Name
Fuca1
UniProt Synonym Gene Names
Fuca; Alpha-L-fucosidase 1
UniProt Entry Name
FUCO_MOUSE
Uniprot Description
FUCA1: Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N- acetylglucosamine of the carbohydrate moieties of glycoproteins. Defects in FUCA1 are the cause of fucosidosis (FUCA1D). FUCA1D is an autosomal recessive lysosomal storage disease characterized by accumulation of fucose-containing glycolipids and glycoproteins in various tissues. Clinical signs include facial dysmorphism, dysostosis multiplex, moderate hepatomegaly, severe intellectual deficit, deafness, and according to age, angiokeratomas. Belongs to the glycosyl hydrolase 29 family.
Protein type: Glycan Metabolism - other glycan degradation; Hydrolase; EC 3.2.1.51
Cellular Component: lysosome
Molecular Function: fucosidase activity; hydrolase activity; alpha-L-fucosidase activity; hydrolase activity, acting on glycosyl bonds; carbohydrate binding; fucose binding
Biological Process: fucose metabolic process; glycoside catabolic process; metabolic process; carbohydrate metabolic process
Similar Products
Product Notes
The Fuca1 fuca1 (Catalog #AAA1406677) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-452. Full Length of Mature Protein. The amino acid sequence is listed below: LAPRRFTPDW QSLDSRPLPS WFDEAKFGVF VHWGVFSVPA WGSEWFWWHW QGDRMPAYQR FMTENYPPGF SYADFAPQFT ARFFHPDQWA ELFQAAGAKY VVLTTKHHEG FTNWPSPVSW NWNSKDVGPH RDLVGELGAA VRKRNIRYGL YHSLLEWFHP LYLLDKKNGF KTQHFVRAKT MPELYDLVNS YKPDLIWSDG EWECPDTYWN STSFLAWLYN DSPVKDEVIV NDRWGQNCSC HHGGYYNCQD KYKPQSLPDH KWEMCTSMDR ASWGYRKDMT MSTIAKENEI IEELVQTVSL GGNYLLNIGP TKDGLIVPIF QERLLAVGKW LQINGEAIYA SKPWRVQSEK NKTVVWYTTK NATVYATFLY WPENGIVNLK SPKTTSATKI TMLGLEGDLS WTQDPLEGVL ISLPQLPPTV LPVEFAWTLK LTKVN . It is sometimes possible for the material contained within the vial of "Tissue alpha-L-fucosidase (Fuca1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
