Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lipid II flippase FtsW (ftsW) Recombinant Protein | Hhal_2092 recombinant protein

Recombinant Halorhodospira halophila Lipid II flippase FtsW (ftsW)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipid II flippase FtsW (ftsW); Recombinant Halorhodospira halophila Lipid II flippase FtsW (ftsW); Recombinant Lipid II flippase FtsW (ftsW); Lipid II flippase FtsW; Cell division protein FtsW; Hhal_2092 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-395
Sequence
MADLAAGVAERGPRLSLWSSLDQRLVWVVAATALLGLVMVASASISMAEQATGDPFYFFKRQIFFALLGLGMALALLQIPLATWERAGPGLLLGALALLVLVLIPGVGREVNGAVRWIPLGVFNLQVAEVVKVLLALYLAGFLVRRQQQLRTSMAAFLVPVLVSAACAFLLLLQPDFGTALMLMALAVGLLYLAGAPLWRFAALVGVLAAAAAALVVYSPYRWQRVTAFMDPWSDPFNTGFQLTQSLIAIGRGDWLGVGLGGSVQKLFYLPEAHTDFVFSVLAEELGWLGVLAVVLLFSYIVWRAMAVGWQCHRHRLPFAGYLAWAVGLALGLQAFINMGVATGLLPTKGLTLPLFSYGGSSALATGAMVGLLLRCGYELAQARAEGRRPEEAAS
Sequence Length
395
Species
Halorhodospira halophila (strain DSM 244 / SL1) (Ectothiorhodospira halophila (strain DSM 244 / SL1))
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,218 Da
NCBI Official Full Name
cell division protein FtsW
NCBI Official Symbol
Hhal_2092
NCBI Protein Information
cell division protein FtsW
UniProt Protein Name
Lipid II flippase FtsW
UniProt Gene Name
ftsW
UniProt Entry Name
FTSW_HALHL

Uniprot Description

Function: Essential cell division protein. Transports lipid-linked peptidoglycan precursors from the inner to the outer leaflet of the cytoplasmic membrane

By similarity. HAMAP-Rule MF_00913

Subcellular location: Cell inner membrane; Multi-pass membrane protein

By similarity. Note: Localizes to the division septum

By similarity. HAMAP-Rule MF_00913

Sequence similarities: Belongs to the SEDS family. FtsW subfamily.

Similar Products

Product Notes

The Hhal_2092 ftsw (Catalog #AAA1132746) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-395. The amino acid sequence is listed below: MADLAAGVAE RGPRLSLWSS LDQRLVWVVA ATALLGLVMV ASASISMAEQ ATGDPFYFFK RQIFFALLGL GMALALLQIP LATWERAGPG LLLGALALLV LVLIPGVGRE VNGAVRWIPL GVFNLQVAEV VKVLLALYLA GFLVRRQQQL RTSMAAFLVP VLVSAACAFL LLLQPDFGTA LMLMALAVGL LYLAGAPLWR FAALVGVLAA AAAALVVYSP YRWQRVTAFM DPWSDPFNTG FQLTQSLIAI GRGDWLGVGL GGSVQKLFYL PEAHTDFVFS VLAEELGWLG VLAVVLLFSY IVWRAMAVGW QCHRHRLPFA GYLAWAVGLA LGLQAFINMG VATGLLPTKG LTLPLFSYGG SSALATGAMV GLLLRCGYEL AQARAEGRRP EEAAS. It is sometimes possible for the material contained within the vial of "Lipid II flippase FtsW (ftsW), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.